PDB entry 1w7b

View 1w7b on RCSB PDB site
Description: annexin a2: does it induce membrane aggregation by a new multimeric state of the protein.
Class: calcium-binding protein
Keywords: calcium-binding protein, annexins, calcium-binding proteins, membrane-binding proteins
Deposited on 2004-09-01, released 2004-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.216
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: annexin a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07355 (Start-338)
      • engineered mutation (65)
    Domains in SCOPe 2.06: d1w7ba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w7bA (A:)
    mstvheilcklslegdhstppsaygsvkaytnfdaerdalnietaiktkgvdevtivnil
    tnrsneqrqdiafayqrrtkkelasalksalsghletvilgllktpaqydaselkasmkg
    lgtdedslieiicsrtnqelqeinrvykemyktdlekdiisdtsgdfrklmvalakgrra
    edgsvidyelidqdardlydagvkrkgtdvpkwisimtersvphlqkvfdryksyspydm
    lesirkevkgdlenaflnlvqciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdm
    lkirsefkrkygkslyyyiqqdtkgdyqkallylcggdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7bA (A:)
    psaygsvkaytnfdaerdalnietaiktkgvdevtivniltnrsneqrqdiafayqrrtk
    kelasalksalsghletvilgllktpaqydaselkasmkglgtdedslieiicsrtnqel
    qeinrvykemyktdlekdiisdtsgdfrklmvalakgrraedgsvidyelidqdardlyd
    agvkrkgtdvpkwisimtersvphlqkvfdryksyspydmlesirkevkgdlenaflnlv
    qciqnkplyfadrlydsmkgkgtrdkvlirimvsrsevdmlkirsefkrkygkslyyyiq
    qdtkgdyqkallylcggdd