PDB entry 1w7a

View 1w7a on RCSB PDB site
Description: atp bound muts
Deposited on 2004-08-31, released 2004-09-10
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-10, with a file datestamp of 2004-09-10.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: 0.21706
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w7aA (A:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgaa
    ddlasgrstfmvemtetanilhnateyslvlmdeigrgtstydglslawacaenlankik
    altlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalag
    vpkevikrarqklrelesis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7aA (A:)
    saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas
    agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtisd
    eallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaellya
    edfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcll
    qyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvtp
    mgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrtar
    prdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvrd
    ggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrgq
    shlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphlea
    lqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianpl
    nlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgast
    fmvemtetanilhnateyslvlmdeigrgtstydglslawacaenlankikaltlfathy
    feltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalagvpkevikra
    rqklrelesis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w7aB (B:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgaa
    ddlasgrstfmvemtetanilhnateyslvlmdeigrgtstydglslawacaenlankik
    altlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalag
    vpkevikrarqklrelesis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w7aB (B:)
    mqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpmagipyhavenylakl
    vnqgesvaicerkvvrivtpgtisdeallqerqdnllaaiwqdskgfgyatldissgrfr
    lsepadretmaaelqrtnpaellyaedfaemsliegrrglrrrplwefeidtarqqlnlq
    fgtrdlvgfgvenaprglcaagcllqyakdtqrttlphirsitmereqdsiimdaatrrn
    leitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtigalqdfta
    glqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsapvqalrek
    mgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdylerlevrere
    rtgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkeyedkvlts
    kgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytlnytcptfidkp
    giritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrqtalialmayi
    gsyvpaqkveigpidriftrvgaaddsgrstfmvemtetanilhnateyslvlmdeigrg
    tstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdtiaf
    mhsvqdgaasksyglavaalagvpkevikrarqklrelesis