PDB entry 1w79

View 1w79 on RCSB PDB site
Description: Crystal structure of the DD-transpeptidase-carboxypeptidase from Actinomadura R39
Class: hydrolase
Keywords: penicillin-binding, peptidoglycan, actinomadura, transpeptidase, antibiotic resistance, hydrolase
Deposited on 2004-08-31, released 2005-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: ACTINOMADURA SP. R39 [TaxId:72570]
    Gene: dac
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w79a1
  • Chain 'B':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: ACTINOMADURA SP. R39 [TaxId:72570]
    Gene: dac
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w79b1
  • Chain 'C':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: ACTINOMADURA SP. R39 [TaxId:72570]
    Gene: dac
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w79c1
  • Chain 'D':
    Compound: d-alanyl-d-alanine carboxypeptidase
    Species: ACTINOMADURA SP. R39 [TaxId:72570]
    Gene: dac
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w79d1
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w79A (A:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapegarmmrgpvqgsge
    lecswvqac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w79A (A:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w79B (B:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapegarmmrgpvqgsge
    lecswvqac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w79B (B:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqape
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w79C (C:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapegarmmrgpvqgsge
    lecswvqac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w79C (C:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqape
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w79D (D:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapegarmmrgpvqgsge
    lecswvqac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w79D (D:)
    rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
    evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
    dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
    dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
    paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
    ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
    vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
    sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapeg