PDB entry 1w77

View 1w77 on RCSB PDB site
Description: 2c-methyl-d-erythritol 4-phosphate cytidylyltransferase (ispd) from arabidopsis thaliana
Class: transferase
Keywords: plantherbicide, cytidylyltransferase, arabidopsis thaliana, non-mevalonate pathway, isoprenoid, transferase
Deposited on 2004-08-30, released 2006-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.237
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2c-methyl-d-erythritol 4-phosphate cytidylyltransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O64726 (0-End)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d1w77a1
  • Heterogens: CD, CU, C5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w77A (A:)
    meksvsvillaggqgkrmkmsmpkqyipllgqpialysfftfsrmpevkeivvvcdpffr
    difeeyeesidvdlrfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvl
    kdgsavgaavlgvpakatikevnsdslvvktldrktlwemqtpqvikpellkkgfelvks
    eglevtddvsiveylkhpvyvsqgsytnikvttpddlllaerilseds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w77A (A:)
    meksvsvillaggsmpkqyipllgqpialysfftfsrmpevkeivvvcdpffrdifeeye
    esidvdlrfaipgkerqdsvysglqeidvnselvcihdsarplvntedvekvlkdgsavg
    aavlgvpakatikevnsdslvvtlwemqtpqvikpellkkgfelvkseglevtdvsivey
    lkhpvyvsqgsytnikvttpddlllaerilse