PDB entry 1w73

View 1w73 on RCSB PDB site
Description: binary structure of human decr solved by semet sad.
Class: oxidoreductase
Keywords: short chain dehydrogenase, reductase, selenomethionine, sad, dienoyl-coa, oxidoreductase
Deposited on 2004-08-27, released 2004-10-28
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,4-dienoyl-CoA reductase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w73a_
  • Chain 'B':
    Compound: 2,4-dienoyl-CoA reductase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w73b_
  • Chain 'C':
    Compound: 2,4-dienoyl-CoA reductase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w73c_
  • Chain 'D':
    Compound: 2,4-dienoyl-CoA reductase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w73d_
  • Heterogens: NAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w73A (A:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgt
    veelanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieelirktk
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w73A (A:)
    ntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkmd
    vlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispte
    rlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasak
    agveamskslaaewgkygmrfnviqpgpiktldptgtfekemigripcgrlgtveelanl
    aaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w73B (B:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgt
    veelanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieelirktk
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w73B (B:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpikekemigripcgrlgtveelanlaaflcsd
    yaswingavikfdggeevlisgefndlrkvtkeqwdtieeli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w73C (C:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgt
    veelanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieelirktk
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w73C (C:)
    tealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkmdv
    lkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispter
    lspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasaka
    gveamskslaaewgkygmrfnviqpgpikttgtfekemigripcgrlgtveelanlaafl
    csdyaswingavikfdggeevlisgefndlrkvtkeqwdtieel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w73D (D:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgt
    veelanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieelirktk
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w73D (D:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkemigripcgrlgtveelanlaaflcsd
    yaswingavikfdggeevlisgefndlrkvtkeqwdtiee