PDB entry 1w70

View 1w70 on RCSB PDB site
Description: sh3 domain of p40phox complexed with c-terminal polyproline region of p47phox
Deposited on 2004-08-26, released 2005-01-18
The last revision was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.1811
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutrophil cytosol factor 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W70 (0-4)
    • Uniprot Q15080 (5-59)
  • Chain 'B':
    Compound: neutrophil cytosol factor 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W70 (0-4)
    • Uniprot Q15080 (5-59)
  • Chain 'C':
    Compound: neutrophil cytosol factor 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W70
    • Uniprot P14598 (0-12)
  • Chain 'D':
    Compound: neutrophil cytosol factor 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W70
    • Uniprot P14598 (0-End)
  • Heterogens: SO4, TFA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1w70A (A:)
    likhmraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1w70B (B:)
    likhmraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1w70C (C:)
    kpqpavpprpsad
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1w70D (D:)
    kpqpavpprpsad
    

    Sequence, based on observed residues (ATOM records):
    >1w70D (D:)
    kpqpavpprps