PDB entry 1w6y

View 1w6y on RCSB PDB site
Description: crystal structure of a mutant w92a in ketosteroid isomerase (ksi) from pseudomonas putida biotype b
Class: isomerase
Keywords: isomerase, solvent-exposed, hydrophobic cluster, conformational stability, ketosteroid isomerase, coneshell, closed barrel, curved b-sheet
Deposited on 2004-08-25, released 2005-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2241
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (91)
    Domains in SCOPe 2.08: d1w6ya1
  • Heterogens: EQU, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1w6yA (A:)
mnlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqg
lgggkvracltgpvrashngcgampfrvemvangqpcaldvidvmrfdehgriqtmqayw
sevnlsvrepq

    Sequence, based on observed residues (ATOM records): (download) 
    >1w6yA (A:)
nlptaqevqglmaryielvdvgdieaivqmyaddatvedpfgqppihgreqiaafyrqgl
ggkvracltgpvrashngcgampfrvemvangqpcaldvidvmrfdehgriqtmqaywse
vnlsvr