PDB entry 1w6x
View 1w6x on RCSB PDB site
Description: sh3 domain of p40phox, component of the nadph oxidase
Class: sh3 domain
Keywords: nadph oxidase, p40phox, phagocyte, sh3 domain
Deposited on
2004-08-24, released
2005-01-18
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2476
AEROSPACI score: 0.39
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: neutrophil cytosol factor 4
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 1W6X (Start-4)
- Uniprot Q15080 (5-59)
Domains in SCOPe 2.03: d1w6xa_ - Chain 'B':
Compound: neutrophil cytosol factor 4
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 1W6X (Start-4)
- Uniprot Q15080 (5-59)
Domains in SCOPe 2.03: d1w6xb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1w6xA (A:)
likhmraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk
Sequence, based on observed residues (ATOM records): (download)
>1w6xA (A:)
mraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1w6xB (B:)
likhmraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk
Sequence, based on observed residues (ATOM records): (download)
>1w6xB (B:)
mraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk