PDB entry 1w6x

View 1w6x on RCSB PDB site
Description: sh3 domain of p40phox, component of the nadph oxidase
Class: sh3 domain
Keywords: nadph oxidase, p40phox, phagocyte, sh3 domain
Deposited on 2004-08-24, released 2005-01-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2476
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutrophil cytosol factor 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W6X (Start-4)
    • Uniprot Q15080 (5-59)
    Domains in SCOPe 2.01: d1w6xa_
  • Chain 'B':
    Compound: neutrophil cytosol factor 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W6X (Start-4)
    • Uniprot Q15080 (5-59)
    Domains in SCOPe 2.01: d1w6xb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w6xA (A:)
    likhmraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6xA (A:)
    mraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w6xB (B:)
    likhmraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6xB (B:)
    mraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkilk