PDB entry 1w6v

View 1w6v on RCSB PDB site
Description: solution structure of the dusp domain of husp15
Class: hydrolase
Keywords: UCH, USP, DUB, DEUBIQUITYLATION, DEUBIQUITINATING ENZYME, UBIQUITIN, UBIQUITIN SPECIFIC PROTEASE, UBIQUITIN CARBOXYTERMINAL HYDROLASE, CLEAVAGE, USP15, DUB15, UBP15, ENDOPEPTIDASE, THIOLESTERASE, DUSP, Structural Proteomics in Europe, SPINE, Structural Genomics
Deposited on 2004-08-24, released 2006-01-12
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-22, with a file datestamp of 2007-06-28.
Experiment type: NMR13
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 1W6V
    • Uniprot Q9Y4E8 (21-140)
    Domains in SCOP 1.73: d1w6va1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w6vA (A:)
    mgsshhhhhhssglvprgshmmaeggaadldtqrsdiatllktslrkgdtwylvdsrwfk
    qwkkyvgfdswdkyqmgdqnvypgpidnsgllkdgdaqslkehlideldyillptegwnk
    lvswytlmegqepiarkvveq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6vA (A:)
    maeggaadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqnv
    ypgpidnsgllkdgdaqslkehlideldyillptegwnklvswytlmegqepiarkvveq