PDB entry 1w6v

View 1w6v on RCSB PDB site
Description: solution structure of the dusp domain of husp15
Class: hydrolase
Keywords: hydrolase, uch, usp, dub, deubiquitylation, deubiquitinating enzyme, ubiquitin, ubiquitin specific protease, ubiquitin carboxyterminal hydrolase, cleavage, usp15, dub15, ubp15, endopeptidase, thiolesterase, dusp, structural proteomics in europe, spine, structural genomics
Deposited on 2004-08-24, released 2006-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin carboxyl-terminal hydrolase 15
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W6V
    • Uniprot Q9Y4E8 (21-140)
    Domains in SCOPe 2.07: d1w6va1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w6vA (A:)
    mgsshhhhhhssglvprgshmmaeggaadldtqrsdiatllktslrkgdtwylvdsrwfk
    qwkkyvgfdswdkyqmgdqnvypgpidnsgllkdgdaqslkehlideldyillptegwnk
    lvswytlmegqepiarkvveq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6vA (A:)
    maeggaadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqnv
    ypgpidnsgllkdgdaqslkehlideldyillptegwnklvswytlmegqepiarkvveq