PDB entry 1w6u

View 1w6u on RCSB PDB site
Description: structure of human decr ternary complex
Class: oxidoreductase
Keywords: dienoyl coa-reductase, short chain dehydrogenase, beta-oxidation, nadp, oxidoreductase, reductase
Deposited on 2004-08-24, released 2004-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.229
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2,4-dienoyl-coa reductase, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W6U
    • Uniprot Q16698 (1-End)
    Domains in SCOPe 2.08: d1w6ua_
  • Chain 'B':
    Compound: 2,4-dienoyl-coa reductase, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W6U (0-0)
    • Uniprot Q16698 (1-End)
    Domains in SCOPe 2.08: d1w6ub_
  • Chain 'C':
    Compound: 2,4-dienoyl-coa reductase, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w6uc_
  • Chain 'D':
    Compound: 2,4-dienoyl-coa reductase, mitochondrial precursor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W6U (0-0)
    • Uniprot Q16698 (1-End)
    Domains in SCOPe 2.08: d1w6ud_
  • Heterogens: NAP, HXC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w6uA (A:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgt
    veelanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieelirktk
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6uA (A:)
    ntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkmd
    vlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispte
    rlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasak
    agveamskslaaewgkygmrfnviqpgpiktldptgtfekemigripcgrlgtveelanl
    aaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w6uB (B:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgt
    veelanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieelirktk
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6uB (B:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktgtfekemigripcgrlgtveelanlaaf
    lcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieeli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w6uC (C:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgt
    veelanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieelirktk
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6uC (C:)
    tealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkmdv
    lkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispter
    lspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasaka
    gveamskslaaewgkygmrfnviqpgpiktgafgtfekemigripcgrlgtveelanlaa
    flcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w6uD (D:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktkgafsrldptgtfekemigripcgrlgt
    veelanlaaflcsdyaswingavikfdggeevlisgefndlrkvtkeqwdtieelirktk
    gs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6uD (D:)
    mntealqskffsplqkamlppnsfqgkvafitgggtglgkgmttllsslgaqcviasrkm
    dvlkataeqissqtgnkvhaiqcdvrdpdmvqntvselikvaghpnivinnaagnfispt
    erlspnawktitdivlngtafvtleigkqlikaqkgaaflsittiyaetgsgfvvpsasa
    kagveamskslaaewgkygmrfnviqpgpiktfekemigripcgrlgtveelanlaaflc
    sdyaswingavikfdggeevlisgefndlrkvtkeqwdtiee