PDB entry 1w6s

View 1w6s on RCSB PDB site
Description: The high resolution structure of methanol dehydrogenase from methylobacterium extorquens
Class: oxidoreductase
Keywords: anisotropic, electron transfer, oxidoreductase, calcium-binding, methanol utilization, pqq
Deposited on 2004-08-23, released 2004-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methanol dehydrogenase subunit 1
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16027
      • conflict (425)
    Domains in SCOPe 2.08: d1w6sa_
  • Chain 'B':
    Compound: methanol dehydrogenase subunit 2
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w6sb_
  • Chain 'C':
    Compound: methanol dehydrogenase subunit 1
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16027 (0-End)
      • conflict (425)
    Domains in SCOPe 2.08: d1w6sc_
  • Chain 'D':
    Compound: methanol dehydrogenase subunit 2
    Species: METHYLOBACTERIUM EXTORQUENS [TaxId:408]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1w6sd_
  • Heterogens: PQQ, GOL, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w6sA (A:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    ewdyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpykagqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6sA (A:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    ewdyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpykagqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w6sB (B:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6sB (B:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w6sC (C:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    ewdyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpykagqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6sC (C:)
    ndklvelsksddnwvmpgknydsnnfsdlkqinkgnvkqlrpawtfstgllnghegaplv
    vdgkmyihtsfpnntfalglddpgtilwqdkpkqnpaaravaccdlvnrglaywpgdgkt
    palilktqldgnvaalnaetgetvwkvensdikvgstltiapyvvkdkviigssgaelgv
    rgyltaydvktgeqvwrayatgpdkdlllasdfniknphygqkglgtgtwegdawkiggg
    tnwgwyaydpgtnliyfgtgnpapwnetmrpgdnkwtmtifgrdadtgeakfgyqktphd
    ewdyagvnvmmlseqkdkdgkarkllthpdrngivytldrtdgalvsanklddtvnvfks
    vdlktgqpvrdpeygtrmdhlakdicpsamgyhnqghdsydpkrelffmginhicmdwep
    fmlpykagqffvgatlnmypgpkgdrqnyeglgqikaynaitgdykwekmerfavwggtm
    atagdlvfygtldgylkardsdtgdllwkfkipsgaigypmtythkgtqyvaiyygvggw
    pgvglvfdladptaglgavgafkklanytqmgggvvvfsldgkgpyddpnvgewksa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w6sD (D:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6sD (D:)
    ydgtkckaagncwepkpgfpekiagskydpkhdpkelnkqadsikqmeernkkrvenfkk
    tgkfeydvakisa