PDB entry 1w6q

View 1w6q on RCSB PDB site
Description: x-ray crystal structure of r111h human galectin-1
Class: lectin
Keywords: carbohydrate-binding proteins, galactosides, galectin, lectin
Deposited on 2004-08-21, released 2004-10-20
The last revision prior to the SCOP 1.75 freeze date was dated 2004-10-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.242
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09382 (0-133)
      • engineered mutation (110)
    Domains in SCOP 1.75: d1w6qa_
  • Chain 'B':
    Compound: galectin-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09382 (0-133)
      • engineered mutation (110)
    Domains in SCOP 1.75: d1w6qb_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w6qA (A:)
    acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnhlnleainym
    aadgdfkikcvafd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w6qB (B:)
    acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnhlnleainym
    aadgdfkikcvafd