PDB entry 1w6q

View 1w6q on RCSB PDB site
Description: x-ray crystal structure of r111h human galectin-1
Class: lectin
Keywords: lectin, carbohydrate-binding proteins, galactosides, galectin
Deposited on 2004-08-21, released 2004-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09382 (0-133)
      • engineered mutation (110)
    Domains in SCOPe 2.08: d1w6qa_
  • Chain 'B':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09382 (0-133)
      • engineered mutation (110)
    Domains in SCOPe 2.08: d1w6qb_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1w6qA (A:)
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnhlnleainym
aadgdfkikcvafd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1w6qB (B:)
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnhlnleainym
aadgdfkikcvafd