PDB entry 1w6p

View 1w6p on RCSB PDB site
Description: x-ray crystal structure of c2s human galectin-1 complexed with n-acetyl-lactosamine
Class: lectin
Keywords: lectin, carbohydrate-binding proteins, galactosides, galectin
Deposited on 2004-08-20, released 2004-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.216
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09382
      • engineered mutation (1)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d1w6pa_
  • Chain 'B':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Domains in SCOPe 2.07: d1w6pb_
  • Heterogens: BME, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1w6pA (A:)
asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1w6pB (B:)
asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd