PDB entry 1w6p

View 1w6p on RCSB PDB site
Description: x-ray crystal structure of c2s human galectin-1 complexed with n-acetyl-lactosamine
Class: lectin
Keywords: carbohydrate-binding proteins, galactosides, galectin, lectin
Deposited on 2004-08-20, released 2004-10-20
The last revision prior to the SCOP 1.73 freeze date was dated 2004-10-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.216
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09382
      • engineered mutation (1)
      • engineered mutation (64)
    Domains in SCOP 1.73: d1w6pa_
  • Chain 'B':
    Compound: galectin-1
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1w6pb_
  • Heterogens: SO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w6pA (A:)
    asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
    aadgdfkikcvafd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w6pB (B:)
    asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
    aadgdfkikcvafd