PDB entry 1w6n

View 1w6n on RCSB PDB site
Description: x-ray crystal structure of c2s human galectin-1
Deposited on 2004-08-19, released 2004-10-20
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-20, with a file datestamp of 2004-10-20.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.21
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1w6na_
  • Chain 'B':
    Domains in SCOP 1.71: d1w6nb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w6nA (A:)
    asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
    aadgdfkikcvafd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w6nB (B:)
    asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
    aadgdfkikcvafd