PDB entry 1w6n

View 1w6n on RCSB PDB site
Description: x-ray crystal structure of c2s human galectin-1
Class: lectin
Keywords: lectin, carbohydrate-binding proteins, galactosides, galectin
Deposited on 2004-08-19, released 2004-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.21
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09382
      • engineered mutation (1)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d1w6na_
  • Chain 'B':
    Compound: galectin-1
    Species: Homo sapiens [TaxId:9606]
    Domains in SCOPe 2.07: d1w6nb_
  • Heterogens: SO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w6nA (A:)
    asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
    aadgdfkikcvafd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w6nB (B:)
    asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
    aadgdfkikcvafd