PDB entry 1w6m

View 1w6m on RCSB PDB site
Description: x-ray crystal structure of c2s human galectin-1 complexed with galactose
Class: lectin
Keywords: carbohydrate-binding proteins, galactosides, galectin, lectin
Deposited on 2004-08-19, released 2004-10-20
The last revision prior to the SCOP 1.73 freeze date was dated 2004-10-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09382 (0-133)
      • engineered mutation (1)
      • engineered mutation (64)
    Domains in SCOP 1.73: d1w6ma_
  • Chain 'B':
    Compound: galectin-1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09382 (0-133)
      • engineered mutation (1)
      • engineered mutation (64)
    Domains in SCOP 1.73: d1w6mb_
  • Heterogens: GAL, SO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w6mA (A:)
    asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
    aadgdfkikcvafd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w6mB (B:)
    asglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
    nskddgawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
    aadgdfkikcvafd