PDB entry 1w6l

View 1w6l on RCSB PDB site
Description: 3d structure of cota incubated with cucl2
Class: oxidase
Keywords: oxidase, multicopper-oxidase, laccase, oxygen reduction, copper
Deposited on 2004-08-19, released 2005-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.149
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spore coat protein a
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w6la1, d1w6la2, d1w6la3
  • Heterogens: CU, OXY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w6lA (A:)
    mtlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgpti
    evkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgype
    awfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkek
    rlklpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvw
    pyleveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaery
    diiidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasyps
    vqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthp
    ihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaat
    fgpysgryvwhchilehedydmmrpmditdphk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6lA (A:)
    tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
    vkrnenvyvkwmnnlpsthflpidhtiheepevktvvhlhggvtpddsdgypeawfskdf
    eqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrlklpsd
    eydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpylevep
    rkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydiiidft
    ayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasypsvqheriq
    nirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthpihlhlvs
    frvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaatfgpysgr
    yvwhchilehedydmmrpmditdp