PDB entry 1w6k

View 1w6k on RCSB PDB site
Description: structure of human osc in complex with lanosterol
Class: isomerase
Keywords: cyclase, cholesterol, lanosterol, monotopic membrane protein, b-octyl-glucoside, isomerase, steroid biosynthesis
Deposited on 2004-08-19, released 2004-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.147
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lanosterol synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w6ka1, d1w6ka2
  • Heterogens: BOG, LAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w6kA (A:)
    mtegtclrrrggpyktepatdlgrwrlncergrqtwtylqderagreqtgleayalgldt
    knyfkdlpkahtafegalngmtfyvglqaedghwtgdyggplfllpgllitchvariplp
    agyreeivrylrsvqlpdggwglhiedkstvfgtalnyvslrilgvgpddpdlvrarnil
    hkkggavaipswgkfwlavlnvysweglntlfpemwlfpdwapahpstlwchcrqvylpm
    sycyavrlsaaedplvqslrqelyvedfasidwlaqrnnvapdelytphswllrvvyall
    nlyehhhsahlrqravqklyehivaddrftksisigpisktinmlvrwyvdgpastafqe
    hvsripdylwmgldgmkmqgtngsqiwdtafaiqalleagghhrpefssclqkaheflrl
    sqvpdnppdyqkyyrqmrkggfsfstldcgwivsdctaealkavlllqekcphvtehipr
    erlcdavavllnmrnpdggfatyetkrgghllellnpsevfgdimidytyvectsavmqa
    lkyfhkrfpehraaeiretltqglefcrrqqradgswegswgvcftygtwfgleafacmg
    qtyrdgtacaevsracdfllsrqmadggwgedfesceerryvqsaqsqihntcwammglm
    avrhpdieaqergvrcllekqlpngdwpqeniagvfnkscaisytsyrnifpiwalgrfs
    qlyperalaghp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6kA (A:)
    clrrrggpyktepatdlgrwrlncergrqtwtylqdagreqtgleayalgldtknyfkdl
    pkahtafegalngmtfyvglqaedghwtgdyggplfllpgllitchvariplpagyreei
    vrylrsvqlpdggwglhiedkstvfgtalnyvslrilgvgpddpdlvrarnilhkkggav
    aipswgkfwlavlnvysweglntlfpemwlfpdwapahpstlwchcrqvylpmsycyavr
    lsaaedplvqslrqelyvedfasidwlaqrnnvapdelytphswllrvvyallnlyehhh
    sahlrqravqklyehivaddrftksisigpisktinmlvrwyvdgpastafqehvsripd
    ylwmgldgmkmqgtngsqiwdtafaiqalleagghhrpefssclqkaheflrlsqvpdnp
    pdyqkyyrqmrkggfsfstldcgwivsdctaealkavlllqekcphvtehiprerlcdav
    avllnmrnpdggfatyetkrgghllellnpsevfgdimidytyvectsavmqalkyfhkr
    fpehraaeiretltqglefcrrqqradgswegswgvcftygtwfgleafacmgqtyrdgt
    acaevsracdfllsrqmadggwgedfesceerryvqsaqsqihntcwammglmavrhpdi
    eaqergvrcllekqlpngdwpqeniagvfnkscaisytsyrnifpiwalgrfsqlypera
    laghp