PDB entry 1w6j

View 1w6j on RCSB PDB site
Description: Structure of human OSC in complex with Ro 48-8071
Class: isomerase
Keywords: cyclase, cholesterol, lanosterol, monotopic membrane protein, b-octyl-glucoside, isomerase, steroid biosynthesis
Deposited on 2004-08-18, released 2004-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lanosterol synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w6ja1, d1w6ja2
  • Heterogens: R71, BOG, C14, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w6jA (A:)
    mtegtclrrrggpyktepatdlgrwrlncergrqtwtylqderagreqtgleayalgldt
    knyfkdlpkahtafegalngmtfyvglqaedghwtgdyggplfllpgllitchvariplp
    agyreeivrylrsvqlpdggwglhiedkstvfgtalnyvslrilgvgpddpdlvrarnil
    hkkggavaipswgkfwlavlnvysweglntlfpemwlfpdwapahpstlwchcrqvylpm
    sycyavrlsaaedplvqslrqelyvedfasidwlaqrnnvapdelytphswllrvvyall
    nlyehhhsahlrqravqklyehivaddrftksisigpisktinmlvrwyvdgpastafqe
    hvsripdylwmgldgmkmqgtngsqiwdtafaiqalleagghhrpefssclqkaheflrl
    sqvpdnppdyqkyyrqmrkggfsfstldcgwivsdctaealkavlllqekcphvtehipr
    erlcdavavllnmrnpdggfatyetkrgghllellnpsevfgdimidytyvectsavmqa
    lkyfhkrfpehraaeiretltqglefcrrqqradgswegswgvcftygtwfgleafacmg
    qtyrdgtacaevsracdfllsrqmadggwgedfesceerrylqsaqsqihntcwammglm
    avrhpdieaqergvrcllekqlpngdwpqeniagvfnkscaisytsyrnifpiwalgrfs
    qlyperalaghp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6jA (A:)
    clrrrggpyktepatdlgrwrlncergrqtwtylqderagreqtgleayalgldtknyfk
    dlpkahtafegalngmtfyvglqaedghwtgdyggplfllpgllitchvariplpagyre
    eivrylrsvqlpdggwglhiedkstvfgtalnyvslrilgvgpddpdlvrarnilhkkgg
    avaipswgkfwlavlnvysweglntlfpemwlfpdwapahpstlwchcrqvylpmsycya
    vrlsaaedplvqslrqelyvedfasidwlaqrnnvapdelytphswllrvvyallnlyeh
    hhsahlrqravqklyehivaddrftksisigpisktinmlvrwyvdgpastafqehvsri
    pdylwmgldgmkmqgtngsqiwdtafaiqalleagghhrpefssclqkaheflrlsqvpd
    nppdyqkyyrqmrkggfsfstldcgwivsdctaealkavlllqekcphvtehiprerlcd
    avavllnmrnpdggfatyetkrgghllellnpsevfgdimidytyvectsavmqalkyfh
    krfpehraaeiretltqglefcrrqqradgswegswgvcftygtwfgleafacmgqtyrd
    gtacaevsracdfllsrqmadggwgedfesceerrylqsaqsqihntcwammglmavrhp
    dieaqergvrcllekqlpngdwpqeniagvfnkscaisytsyrnifpiwalgrfsqlype
    ralaghp