PDB entry 1w6i

View 1w6i on RCSB PDB site
Description: plasmepsin II-pepstatin a complex
Class: hydrolase
Keywords: malaria,drug, aspartic protease, plasmepsin, hydrolase, glycoprotein
Deposited on 2004-08-18, released 2006-07-05
The last revision prior to the SCOP 1.75 freeze date was dated 2006-07-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmepsin 2 precursor
    Species: Plasmodium falciparum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1w6ia1
  • Chain 'C':
    Compound: plasmepsin 2 precursor
    Species: Plasmodium falciparum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1w6ic1
  • Heterogens: IHN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w6iA (A:)
    lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
    dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
    tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
    egpltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvik
    vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
    filgdpfmrkyftvfdydnhsvgialakknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6iA (A:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w6iC (C:)
    lgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhly
    dssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytas
    tfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfy
    egpltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvik
    vpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvpt
    filgdpfmrkyftvfdydnhsvgialakknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w6iC (C:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl