PDB entry 1w6b

View 1w6b on RCSB PDB site
Description: solution nmr structure of a long neurotoxin from the venom of the asian cobra, 20 structures
Class: toxin
Keywords: venom, long neurotoxin, toxin
Deposited on 2004-08-17, released 2004-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: long neurotoxin 1
    Species: NAJA OXIANA [TaxId:8657]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w6ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w6bA (A:)
    itcyktpipitsetcapgqnlcytktwcdawcgsrgkvielgcaatcptvesyqdikccs
    tddcnphpkqkrp