PDB entry 1w68

View 1w68 on RCSB PDB site
Description: crystal structure of mouse ribonucleotide reductase subunit r2 under oxidizing conditions. a fully occupied dinuclear iron cluster.
Deposited on 2004-08-16, released 2004-08-26
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-26, with a file datestamp of 2004-08-26.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1w68a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w68A (A:)
    mlsvrtplatiadqqqlqlsplkrltladkentpptlsstrvlaskaarrifqdsaeles
    kaptnpsvedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhweal
    kpderhfishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysll
    idtyikdpkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgs
    fasifwlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavri
    eqefltealpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpfdfmenislegkt
    nffekrvgeyqrmgvmsnstensftldadf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w68A (A:)
    vedepllrenprrfvvfpieyhdiwqmykkaeasfwtaeevdlskdiqhwealkpderhf
    ishvlaffaasdgivnenlverfsqevqvtearcfygfqiamenihsemysllidtyikd
    pkereylfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasifwl
    kkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpaeqrvreiitnavrieqeflte
    alpvkligmnctlmkqyiefvadrlmlelgfnkifrvenpf