PDB entry 1w66

View 1w66 on RCSB PDB site
Description: structure of a lipoate-protein ligase b from mycobacterium tuberculosis
Class: transferase
Keywords: LIPOATE-PROTEIN LIGASE B, LIPOYLTRANSFERASE, LIPOIC ACID, ACYLTRANSFERASE, TRANSFERASE, Mycobacterium Tuberculosis Structural Proteomics Project, XMTB, Structural Genomics
Deposited on 2004-08-13, released 2005-12-08
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: 0.1168
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoyltransferase
    Species: MYCOBACTERIUM TUBERCULOSIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w66a1
  • Heterogens: DKA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w66A (A:)
    gamagsirsklsaidvrqlgtvdyrtawqlqreladarvaggadtllllehpavytagrr
    tetherpidgtpvvdtdrggkitwhgpgqlvgypiiglaepldvvnyvrrleesliqvca
    dlglhagrvdgrsgvwlpgrparkvaaigvrvsrattlhgfalncdcdlaaftaivpcgi
    sdaavtslsaelgrtvtvdevratvaaavcaaldgvlpvgdrvpshavpspl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w66A (A:)
    gamagsirsklsaidvrqlgtvdyrtawqlqreladarvaggadtllllehpavytagrr
    tetherpidgtpvvdtdrggkitwhgpgqlvgypiiglaepldvvnyvrrleesliqvca
    dlglhagrvdgrsgvwlpgrparkvaaigvrvsrattlhgfalncdcdlaaftaivpcgi
    sdaavtslsaelgrtvtvdevratvaaavcaaldgvlp