PDB entry 1w66

View 1w66 on RCSB PDB site
Description: structure of a lipoate-protein ligase b from mycobacterium tuberculosis
Class: transferase
Keywords: lipoate-protein ligase b, lipoyltransferase, lipoic acid, acyltransferase, transferase, mycobacterium tuberculosis structural proteomics project, xmtb, structural genomics
Deposited on 2004-08-13, released 2005-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: 0.1168
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lipoyltransferase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W66 (0-1)
    • Uniprot Q10404 (2-End)
    Domains in SCOPe 2.07: d1w66a1, d1w66a2
  • Heterogens: DKA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w66A (A:)
    gamagsirsklsaidvrqlgtvdyrtawqlqreladarvaggadtllllehpavytagrr
    tetherpidgtpvvdtdrggkitwhgpgqlvgypiiglaepldvvnyvrrleesliqvca
    dlglhagrvdgrsgvwlpgrparkvaaigvrvsrattlhgfalncdcdlaaftaivpcgi
    sdaavtslsaelgrtvtvdevratvaaavcaaldgvlpvgdrvpshavpspl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w66A (A:)
    gamagsirsklsaidvrqlgtvdyrtawqlqreladarvaggadtllllehpavytagrr
    tetherpidgtpvvdtdrggkitwhgpgqlvgypiiglaepldvvnyvrrleesliqvca
    dlglhagrvdgrsgvwlpgrparkvaaigvrvsrattlhgfalncdcdlaaftaivpcgi
    sdaavtslsaelgrtvtvdevratvaaavcaaldgvlp