PDB entry 1w63

View 1w63 on RCSB PDB site
Description: ap1 clathrin adaptor core
Class: endocytosis
Keywords: endocytosis, clathrin adaptor, transport, coated pits
Deposited on 2004-08-12, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.2972
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adapter-related protein complex 1 gamma 1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W63
    • Uniprot P22892 (5-End)
    Domains in SCOPe 2.07: d1w63a_
  • Chain 'B':
    Compound: adapter-related protein complex 1 beta 1 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52303 (Start-583)
      • conflict (154)
      • conflict (438)
      • conflict (458)
    Domains in SCOPe 2.07: d1w63b_
  • Chain 'C':
    Compound: adapter-related protein complex 1 gamma 1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W63
    • Uniprot P22892 (5-End)
    Domains in SCOPe 2.07: d1w63c_
  • Chain 'D':
    Compound: adapter-related protein complex 1 beta 1 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52303 (Start-583)
      • conflict (154)
      • conflict (438)
      • conflict (458)
    Domains in SCOPe 2.07: d1w63d_
  • Chain 'E':
    Compound: adapter-related protein complex 1 gamma 1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W63
    • Uniprot P22892 (5-End)
    Domains in SCOPe 2.07: d1w63e_
  • Chain 'F':
    Compound: adapter-related protein complex 1 beta 1 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52303 (Start-583)
      • conflict (154)
      • conflict (438)
      • conflict (458)
    Domains in SCOPe 2.07: d1w63f_
  • Chain 'G':
    Compound: adapter-related protein complex 1 gamma 1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W63
    • Uniprot P22892 (5-End)
    Domains in SCOPe 2.07: d1w63g_
  • Chain 'H':
    Compound: adapter-related protein complex 1 beta 1 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52303 (Start-583)
      • conflict (154)
      • conflict (438)
      • conflict (458)
    Domains in SCOPe 2.07: d1w63h_
  • Chain 'I':
    Compound: adapter-related protein complex 1 gamma 1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W63
    • Uniprot P22892 (5-End)
    Domains in SCOPe 2.07: d1w63i_
  • Chain 'J':
    Compound: adapter-related protein complex 1 beta 1 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52303 (Start-583)
      • conflict (154)
      • conflict (438)
      • conflict (458)
    Domains in SCOPe 2.07: d1w63j_
  • Chain 'K':
    Compound: adapter-related protein complex 1 gamma 1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W63
    • Uniprot P22892 (5-End)
    Domains in SCOPe 2.07: d1w63k_
  • Chain 'L':
    Compound: adapter-related protein complex 1 beta 1 subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52303 (Start-583)
      • conflict (154)
      • conflict (438)
      • conflict (458)
    Domains in SCOPe 2.07: d1w63l_
  • Chain 'M':
    Compound: adaptor-related protein complex 1, mu 1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35585 (Start-422)
      • conflict (133)
      • conflict (405)
    Domains in SCOPe 2.07: d1w63m_
  • Chain 'N':
    Compound: adaptor-related protein complex 1, mu 1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35585 (Start-422)
      • conflict (133)
      • conflict (405)
    Domains in SCOPe 2.07: d1w63n_
  • Chain 'O':
    Compound: adaptor-related protein complex 1, mu 1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35585 (Start-422)
      • conflict (133)
      • conflict (405)
    Domains in SCOPe 2.07: d1w63o_
  • Chain 'P':
    Compound: adaptor-related protein complex 1, mu 1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35585 (Start-422)
      • conflict (133)
      • conflict (405)
    Domains in SCOPe 2.07: d1w63p_
  • Chain 'Q':
    Compound: adapter-related protein complex 1 sigma 1a subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w63q_
  • Chain 'R':
    Compound: adaptor-related protein complex 1, mu 1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35585 (Start-422)
      • conflict (133)
      • conflict (405)
    Domains in SCOPe 2.07: d1w63r_
  • Chain 'S':
    Compound: adapter-related protein complex 1 sigma 1a subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w63s_
  • Chain 'T':
    Compound: adapter-related protein complex 1 sigma 1a subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w63t_
  • Chain 'U':
    Compound: adapter-related protein complex 1 sigma 1a subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w63u_
  • Chain 'V':
    Compound: adaptor-related protein complex 1, mu 1 subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35585 (Start-422)
      • conflict (133)
      • conflict (405)
    Domains in SCOPe 2.07: d1w63v_
  • Chain 'W':
    Compound: adapter-related protein complex 1 sigma 1a subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w63w_
  • Chain 'X':
    Compound: adapter-related protein complex 1 sigma 1a subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w63x_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w63A (A:)
    gagmsmpapirlrelirtirtartqaeeremiqkecaairssfreedntyrcrnvaklly
    mhmlgypahfgqleclkliasqkftdkrigylgamlllderqdvhllmtncikndlnhst
    qfvqglalctlgcmgssemcrdlagevekllktsnsylrkkaalcavhvirkvpelmemf
    lpatknllneknhgvlhtsvvlltemcerspdmlahfrklvpqlvrilknlimsgyspeh
    dvsgisdpflqvrilrllrilgrndddsseamndilaqvatntetsknvgnailyetvlt
    imdiksesglrvlainilgrfllnndkniryvaltsllktvqtdhnavqrhrstivdclk
    dldvsikrramelsfalvngnnirgmmkellyfldscepefkadcasgiflaaekyapsk
    rwhidtimrvlttagsyvrddavpnliqlitnsvemhaytvqrlykailgdysqqplvqv
    aawcigeygdllvsgqceeeepiqvtedevldilesvlisnmstsvtrgyaltaimklst
    rftctvnrikkvvsiygssidvelqqraveynalfkkydhmrsallermpvmekvttngp
    seivqtngetepapletk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63A (A:)
    mpapirlrelirtirtartqaeeremiqkecaairssfreedntyrcrnvakllymhmlg
    ypahfgqleclkliasqkftdkrigylgamlllderqdvhllmtncikndlnhstqfvqg
    lalctlgcmgssemcrdlagevekllktsnsylrkkaalcavhvirkvpelmemflpatk
    nllneknhgvlhtsvvlltemcerspdmlahfrklvpqlvrilknlimsgyspehdvsgi
    sdpflqvrilrllrilgrndddsseamndilaqvatntetsknvgnailyetvltimdik
    sesglrvlainilgrfllnndkniryvaltsllktvqtdhnavqrhrstivdclkdldvs
    ikrramelsfalvngnnirgmmkellyfldscepefkadcasgiflaaekyapskrwhid
    timrvlttagsyvrddavpnliqlitnsvemhaytvqrlykailgdysqqplvqvaawci
    geygdllvsgqceeeepiqvtedevldilesvlisnmstsvtrgyaltaimklstrftct
    vnrikkvvsiygssidvelqqraveynalfkkydhmrsallermpvmekv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w63B (B:)
    mtdskyftttkkgeifelkaelnsdkkekkkeavkkviasmtvgkdvsalfpdvvncmqt
    dnlelkklvylylmnyaksqpdmaimavntfvkdcedpnpliralavrtmgcirvdkite
    ylceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldtlkdlisdsnpmvvanr
    vaalseiaeshpssnlldlkaqsinklltalnectewaqifildclgnympkddreaqsi
    cervtprlshansavvlsavkvlmkfmemlskdldyyatllkklapplvtllsaepepqy
    vplrninlivqkrpeilkhemkvffvkyndpiyvklekldimirlasqaniaqvlaelke
    yatevdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvikdifrk
    ypnkyesviatlcenldsddepearaamiwivgeyaersdnadellesfldgfhdestqv
    qlqlltaivklflkkptetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvaakev
    vlaekpliseetdlieptlldelicyigtlasvyhkppnafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63B (B:)
    tdskyftttkkgeifelkaelnsdkkekkkeavkkviasmtvgkdvsalfpdvvncmqtd
    nlelkklvylylmnyaksqpdmaimavntfvkdcedpnpliralavrtmgcirvdkitey
    lceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldtlkdlisdsnpmvvanrv
    aalseiaeshpssnlldlkaqsinklltalnectewaqifildclgnympkddreaqsic
    ervtprlshansavvlsavkvlmkfmdyyatllkklapplvtllsaepepqyvplrninl
    ivqkrpeilkhemkvffvkyndpiyvklekldimirlasqaniaqvlaelkeyatevdvd
    fvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvikdifrkypnkyesv
    iatlcenldsddepearaamiwivgeyaersdnadellesfldgfhdestqvqlqlltai
    vklflkkptetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvaakevvlaekpli
    seetdlieptlldelicyigtlasvyhkppnafveg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w63C (C:)
    gagmsmpapirlrelirtirtartqaeeremiqkecaairssfreedntyrcrnvaklly
    mhmlgypahfgqleclkliasqkftdkrigylgamlllderqdvhllmtncikndlnhst
    qfvqglalctlgcmgssemcrdlagevekllktsnsylrkkaalcavhvirkvpelmemf
    lpatknllneknhgvlhtsvvlltemcerspdmlahfrklvpqlvrilknlimsgyspeh
    dvsgisdpflqvrilrllrilgrndddsseamndilaqvatntetsknvgnailyetvlt
    imdiksesglrvlainilgrfllnndkniryvaltsllktvqtdhnavqrhrstivdclk
    dldvsikrramelsfalvngnnirgmmkellyfldscepefkadcasgiflaaekyapsk
    rwhidtimrvlttagsyvrddavpnliqlitnsvemhaytvqrlykailgdysqqplvqv
    aawcigeygdllvsgqceeeepiqvtedevldilesvlisnmstsvtrgyaltaimklst
    rftctvnrikkvvsiygssidvelqqraveynalfkkydhmrsallermpvmekvttngp
    seivqtngetepapletk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63C (C:)
    mpapirlrelirtirtartqaeeremiqkecaairssfreedntyrcrnvakllymhmlg
    ypahfgqleclkliasqkftdkrigylgamlllderqdvhllmtncikndlnhstqfvqg
    lalctlgcmgssemcrdlagevekllktsnsylrkkaalcavhvirkvpelmemflpatk
    nllneknhgvlhtsvvlltemcerspdmlahfrklvpqlvrilknlimsgyspehdvsgi
    sdpflqvrilrllrilgrndddsseamndilaqvatntetsknvgnailyetvltimdik
    sesglrvlainilgrfllnndkniryvaltsllktvqtdhnavqrhrstivdclkdldvs
    ikrramelsfalvngnnirgmmkellyfldscepefkadcasgiflaaekyapskrwhid
    timrvlttagsyvrddavpnliqlitnsvemhaytvqrlykailgdysqqplvqvaawci
    geygdllvsgqceeeepiqvtedevldilesvlisnmstsvtrgyaltaimklstrftct
    vnrikkvvsiygssidvelqqraveynalfkkydhmrsallermpvmekv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w63D (D:)
    mtdskyftttkkgeifelkaelnsdkkekkkeavkkviasmtvgkdvsalfpdvvncmqt
    dnlelkklvylylmnyaksqpdmaimavntfvkdcedpnpliralavrtmgcirvdkite
    ylceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldtlkdlisdsnpmvvanr
    vaalseiaeshpssnlldlkaqsinklltalnectewaqifildclgnympkddreaqsi
    cervtprlshansavvlsavkvlmkfmemlskdldyyatllkklapplvtllsaepepqy
    vplrninlivqkrpeilkhemkvffvkyndpiyvklekldimirlasqaniaqvlaelke
    yatevdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvikdifrk
    ypnkyesviatlcenldsddepearaamiwivgeyaersdnadellesfldgfhdestqv
    qlqlltaivklflkkptetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvaakev
    vlaekpliseetdlieptlldelicyigtlasvyhkppnafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63D (D:)
    tdskyftttkkgeifelkaelnsdkkekkkeavkkviasmtvgkdvsalfpdvvncmqtd
    nlelkklvylylmnyaksqpdmaimavntfvkdcedpnpliralavrtmgcirvdkitey
    lceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldtlkdlisdsnpmvvanrv
    aalseiaeshpssnlldlkaqsinklltalnectewaqifildclgnympkddreaqsic
    ervtprlshansavvlsavkvlmkfmdyyatllkklapplvtllsaepepqyvplrninl
    ivqkrpeilkhemkvffvkyndpiyvklekldimirlasqaniaqvlaelkeyatevdvd
    fvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvikdifrkypnkyesv
    iatlcenldsddepearaamiwivgeyaersdnadellesfldgfhdestqvqlqlltai
    vklflkkptetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvaakevvlaekpli
    seetdlieptlldelicyigtlasvyhkppnafveg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w63E (E:)
    gagmsmpapirlrelirtirtartqaeeremiqkecaairssfreedntyrcrnvaklly
    mhmlgypahfgqleclkliasqkftdkrigylgamlllderqdvhllmtncikndlnhst
    qfvqglalctlgcmgssemcrdlagevekllktsnsylrkkaalcavhvirkvpelmemf
    lpatknllneknhgvlhtsvvlltemcerspdmlahfrklvpqlvrilknlimsgyspeh
    dvsgisdpflqvrilrllrilgrndddsseamndilaqvatntetsknvgnailyetvlt
    imdiksesglrvlainilgrfllnndkniryvaltsllktvqtdhnavqrhrstivdclk
    dldvsikrramelsfalvngnnirgmmkellyfldscepefkadcasgiflaaekyapsk
    rwhidtimrvlttagsyvrddavpnliqlitnsvemhaytvqrlykailgdysqqplvqv
    aawcigeygdllvsgqceeeepiqvtedevldilesvlisnmstsvtrgyaltaimklst
    rftctvnrikkvvsiygssidvelqqraveynalfkkydhmrsallermpvmekvttngp
    seivqtngetepapletk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63E (E:)
    mpapirlrelirtirtartqaeeremiqkecaairssfreedntyrcrnvakllymhmlg
    ypahfgqleclkliasqkftdkrigylgamlllderqdvhllmtncikndlnhstqfvqg
    lalctlgcmgssemcrdlagevekllktsnsylrkkaalcavhvirkvpelmemflpatk
    nllneknhgvlhtsvvlltemcerspdmlahfrklvpqlvrilknlimsgyspehdvsgi
    sdpflqvrilrllrilgrndddsseamndilaqvatntetsknvgnailyetvltimdik
    sesglrvlainilgrfllnndkniryvaltsllktvqtdhnavqrhrstivdclkdldvs
    ikrramelsfalvngnnirgmmkellyfldscepefkadcasgiflaaekyapskrwhid
    timrvlttagsyvrddavpnliqlitnsvemhaytvqrlykailgdysqqplvqvaawci
    geygdllvsgqceeeepiqvtedevldilesvlisnmstsvtrgyaltaimklstrftct
    vnrikkvvsiygssidvelqqraveynalfkkydhmrsallermpvmekv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w63F (F:)
    mtdskyftttkkgeifelkaelnsdkkekkkeavkkviasmtvgkdvsalfpdvvncmqt
    dnlelkklvylylmnyaksqpdmaimavntfvkdcedpnpliralavrtmgcirvdkite
    ylceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldtlkdlisdsnpmvvanr
    vaalseiaeshpssnlldlkaqsinklltalnectewaqifildclgnympkddreaqsi
    cervtprlshansavvlsavkvlmkfmemlskdldyyatllkklapplvtllsaepepqy
    vplrninlivqkrpeilkhemkvffvkyndpiyvklekldimirlasqaniaqvlaelke
    yatevdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvikdifrk
    ypnkyesviatlcenldsddepearaamiwivgeyaersdnadellesfldgfhdestqv
    qlqlltaivklflkkptetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvaakev
    vlaekpliseetdlieptlldelicyigtlasvyhkppnafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63F (F:)
    tdskyftttkkgeifelkaelnsdkkekkkeavkkviasmtvgkdvsalfpdvvncmqtd
    nlelkklvylylmnyaksqpdmaimavntfvkdcedpnpliralavrtmgcirvdkitey
    lceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldtlkdlisdsnpmvvanrv
    aalseiaeshpssnlldlkaqsinklltalnectewaqifildclgnympkddreaqsic
    ervtprlshansavvlsavkvlmkfmdyyatllkklapplvtllsaepepqyvplrninl
    ivqkrpeilkhemkvffvkyndpiyvklekldimirlasqaniaqvlaelkeyatevdvd
    fvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvikdifrkypnkyesv
    iatlcenldsddepearaamiwivgeyaersdnadellesfldgfhdestqvqlqlltai
    vklflkkptetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvaakevvlaekpli
    seetdlieptlldelicyigtlasvyhkppnafveg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w63G (G:)
    gagmsmpapirlrelirtirtartqaeeremiqkecaairssfreedntyrcrnvaklly
    mhmlgypahfgqleclkliasqkftdkrigylgamlllderqdvhllmtncikndlnhst
    qfvqglalctlgcmgssemcrdlagevekllktsnsylrkkaalcavhvirkvpelmemf
    lpatknllneknhgvlhtsvvlltemcerspdmlahfrklvpqlvrilknlimsgyspeh
    dvsgisdpflqvrilrllrilgrndddsseamndilaqvatntetsknvgnailyetvlt
    imdiksesglrvlainilgrfllnndkniryvaltsllktvqtdhnavqrhrstivdclk
    dldvsikrramelsfalvngnnirgmmkellyfldscepefkadcasgiflaaekyapsk
    rwhidtimrvlttagsyvrddavpnliqlitnsvemhaytvqrlykailgdysqqplvqv
    aawcigeygdllvsgqceeeepiqvtedevldilesvlisnmstsvtrgyaltaimklst
    rftctvnrikkvvsiygssidvelqqraveynalfkkydhmrsallermpvmekvttngp
    seivqtngetepapletk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63G (G:)
    mpapirlrelirtirtartqaeeremiqkecaairssfreedntyrcrnvakllymhmlg
    ypahfgqleclkliasqkftdkrigylgamlllderqdvhllmtncikndlnhstqfvqg
    lalctlgcmgssemcrdlagevekllktsnsylrkkaalcavhvirkvpelmemflpatk
    nllneknhgvlhtsvvlltemcerspdmlahfrklvpqlvrilknlimsgyspehdvsgi
    sdpflqvrilrllrilgrndddsseamndilaqvatntetsknvgnailyetvltimdik
    sesglrvlainilgrfllnndkniryvaltsllktvqtdhnavqrhrstivdclkdldvs
    ikrramelsfalvngnnirgmmkellyfldscepefkadcasgiflaaekyapskrwhid
    timrvlttagsyvrddavpnliqlitnsvemhaytvqrlykailgdysqqplvqvaawci
    geygdllvsgqceeeepiqvtedevldilesvlisnmstsvtrgyaltaimklstrftct
    vnrikkvvsiygssidvelqqraveynalfkkydhmrsallermpvmekv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1w63H (H:)
    mtdskyftttkkgeifelkaelnsdkkekkkeavkkviasmtvgkdvsalfpdvvncmqt
    dnlelkklvylylmnyaksqpdmaimavntfvkdcedpnpliralavrtmgcirvdkite
    ylceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldtlkdlisdsnpmvvanr
    vaalseiaeshpssnlldlkaqsinklltalnectewaqifildclgnympkddreaqsi
    cervtprlshansavvlsavkvlmkfmemlskdldyyatllkklapplvtllsaepepqy
    vplrninlivqkrpeilkhemkvffvkyndpiyvklekldimirlasqaniaqvlaelke
    yatevdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvikdifrk
    ypnkyesviatlcenldsddepearaamiwivgeyaersdnadellesfldgfhdestqv
    qlqlltaivklflkkptetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvaakev
    vlaekpliseetdlieptlldelicyigtlasvyhkppnafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63H (H:)
    tdskyftttkkgeifelkaelnsdkkekkkeavkkviasmtvgkdvsalfpdvvncmqtd
    nlelkklvylylmnyaksqpdmaimavntfvkdcedpnpliralavrtmgcirvdkitey
    lceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldtlkdlisdsnpmvvanrv
    aalseiaeshpssnlldlkaqsinklltalnectewaqifildclgnympkddreaqsic
    ervtprlshansavvlsavkvlmkfmdyyatllkklapplvtllsaepepqyvplrninl
    ivqkrpeilkhemkvffvkyndpiyvklekldimirlasqaniaqvlaelkeyatevdvd
    fvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvikdifrkypnkyesv
    iatlcenldsddepearaamiwivgeyaersdnadellesfldgfhdestqvqlqlltai
    vklflkkptetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvaakevvlaekpli
    seetdlieptlldelicyigtlasvyhkppnafveg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1w63I (I:)
    gagmsmpapirlrelirtirtartqaeeremiqkecaairssfreedntyrcrnvaklly
    mhmlgypahfgqleclkliasqkftdkrigylgamlllderqdvhllmtncikndlnhst
    qfvqglalctlgcmgssemcrdlagevekllktsnsylrkkaalcavhvirkvpelmemf
    lpatknllneknhgvlhtsvvlltemcerspdmlahfrklvpqlvrilknlimsgyspeh
    dvsgisdpflqvrilrllrilgrndddsseamndilaqvatntetsknvgnailyetvlt
    imdiksesglrvlainilgrfllnndkniryvaltsllktvqtdhnavqrhrstivdclk
    dldvsikrramelsfalvngnnirgmmkellyfldscepefkadcasgiflaaekyapsk
    rwhidtimrvlttagsyvrddavpnliqlitnsvemhaytvqrlykailgdysqqplvqv
    aawcigeygdllvsgqceeeepiqvtedevldilesvlisnmstsvtrgyaltaimklst
    rftctvnrikkvvsiygssidvelqqraveynalfkkydhmrsallermpvmekvttngp
    seivqtngetepapletk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63I (I:)
    mpapirlrelirtirtartqaeeremiqkecaairssfreedntyrcrnvakllymhmlg
    ypahfgqleclkliasqkftdkrigylgamlllderqdvhllmtncikndlnhstqfvqg
    lalctlgcmgssemcrdlagevekllktsnsylrkkaalcavhvirkvpelmemflpatk
    nllneknhgvlhtsvvlltemcerspdmlahfrklvpqlvrilknlimsgyspehdvsgi
    sdpflqvrilrllrilgrndddsseamndilaqvatntetsknvgnailyetvltimdik
    sesglrvlainilgrfllnndkniryvaltsllktvqtdhnavqrhrstivdclkdldvs
    ikrramelsfalvngnnirgmmkellyfldscepefkadcasgiflaaekyapskrwhid
    timrvlttagsyvrddavpnliqlitnsvemhaytvqrlykailgdysqqplvqvaawci
    geygdllvsgqceeeepiqvtedevldilesvlisnmstsvtrgyaltaimklstrftct
    vnrikkvvsiygssidvelqqraveynalfkkydhmrsallermpvmekv
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1w63J (J:)
    mtdskyftttkkgeifelkaelnsdkkekkkeavkkviasmtvgkdvsalfpdvvncmqt
    dnlelkklvylylmnyaksqpdmaimavntfvkdcedpnpliralavrtmgcirvdkite
    ylceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldtlkdlisdsnpmvvanr
    vaalseiaeshpssnlldlkaqsinklltalnectewaqifildclgnympkddreaqsi
    cervtprlshansavvlsavkvlmkfmemlskdldyyatllkklapplvtllsaepepqy
    vplrninlivqkrpeilkhemkvffvkyndpiyvklekldimirlasqaniaqvlaelke
    yatevdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvikdifrk
    ypnkyesviatlcenldsddepearaamiwivgeyaersdnadellesfldgfhdestqv
    qlqlltaivklflkkptetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvaakev
    vlaekpliseetdlieptlldelicyigtlasvyhkppnafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63J (J:)
    tdskyftttkkgeifelkaelnsdkkekkkeavkkviasmtvgkdvsalfpdvvncmqtd
    nlelkklvylylmnyaksqpdmaimavntfvkdcedpnpliralavrtmgcirvdkitey
    lceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldtlkdlisdsnpmvvanrv
    aalseiaeshpssnlldlkaqsinklltalnectewaqifildclgnympkddreaqsic
    ervtprlshansavvlsavkvlmkfmdyyatllkklapplvtllsaepepqyvplrninl
    ivqkrpeilkhemkvffvkyndpiyvklekldimirlasqaniaqvlaelkeyatevdvd
    fvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvikdifrkypnkyesv
    iatlcenldsddepearaamiwivgeyaersdnadellesfldgfhdestqvqlqlltai
    vklflkkptetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvaakevvlaekpli
    seetdlieptlldelicyigtlasvyhkppnafveg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1w63K (K:)
    gagmsmpapirlrelirtirtartqaeeremiqkecaairssfreedntyrcrnvaklly
    mhmlgypahfgqleclkliasqkftdkrigylgamlllderqdvhllmtncikndlnhst
    qfvqglalctlgcmgssemcrdlagevekllktsnsylrkkaalcavhvirkvpelmemf
    lpatknllneknhgvlhtsvvlltemcerspdmlahfrklvpqlvrilknlimsgyspeh
    dvsgisdpflqvrilrllrilgrndddsseamndilaqvatntetsknvgnailyetvlt
    imdiksesglrvlainilgrfllnndkniryvaltsllktvqtdhnavqrhrstivdclk
    dldvsikrramelsfalvngnnirgmmkellyfldscepefkadcasgiflaaekyapsk
    rwhidtimrvlttagsyvrddavpnliqlitnsvemhaytvqrlykailgdysqqplvqv
    aawcigeygdllvsgqceeeepiqvtedevldilesvlisnmstsvtrgyaltaimklst
    rftctvnrikkvvsiygssidvelqqraveynalfkkydhmrsallermpvmekvttngp
    seivqtngetepapletk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63K (K:)
    mpapirlrelirtirtartqaeeremiqkecaairssfreedntyrcrnvakllymhmlg
    ypahfgqleclkliasqkftdkrigylgamlllderqdvhllmtncikndlnhstqfvqg
    lalctlgcmgssemcrdlagevekllktsnsylrkkaalcavhvirkvpelmemflpatk
    nllneknhgvlhtsvvlltemcerspdmlahfrklvpqlvrilknlimsgyspehdvsgi
    sdpflqvrilrllrilgrndddsseamndilaqvatntetsknvgnailyetvltimdik
    sesglrvlainilgrfllnndkniryvaltsllktvqtdhnavqrhrstivdclkdldvs
    ikrramelsfalvngnnirgmmkellyfldscepefkadcasgiflaaekyapskrwhid
    timrvlttagsyvrddavpnliqlitnsvemhaytvqrlykailgdysqqplvqvaawci
    geygdllvsgqceeeepiqvtedevldilesvlisnmstsvtrgyaltaimklstrftct
    vnrikkvvsiygssidvelqqraveynalfkkydhmrsallermpvmekv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1w63L (L:)
    mtdskyftttkkgeifelkaelnsdkkekkkeavkkviasmtvgkdvsalfpdvvncmqt
    dnlelkklvylylmnyaksqpdmaimavntfvkdcedpnpliralavrtmgcirvdkite
    ylceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldtlkdlisdsnpmvvanr
    vaalseiaeshpssnlldlkaqsinklltalnectewaqifildclgnympkddreaqsi
    cervtprlshansavvlsavkvlmkfmemlskdldyyatllkklapplvtllsaepepqy
    vplrninlivqkrpeilkhemkvffvkyndpiyvklekldimirlasqaniaqvlaelke
    yatevdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvikdifrk
    ypnkyesviatlcenldsddepearaamiwivgeyaersdnadellesfldgfhdestqv
    qlqlltaivklflkkptetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvaakev
    vlaekpliseetdlieptlldelicyigtlasvyhkppnafveg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63L (L:)
    tdskyftttkkgeifelkaelnsdkkekkkeavkkviasmtvgkdvsalfpdvvncmqtd
    nlelkklvylylmnyaksqpdmaimavntfvkdcedpnpliralavrtmgcirvdkitey
    lceplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldtlkdlisdsnpmvvanrv
    aalseiaeshpssnlldlkaqsinklltalnectewaqifildclgnympkddreaqsic
    ervtprlshansavvlsavkvlmkfmdyyatllkklapplvtllsaepepqyvplrninl
    ivqkrpeilkhemkvffvkyndpiyvklekldimirlasqaniaqvlaelkeyatevdvd
    fvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvikdifrkypnkyesv
    iatlcenldsddepearaamiwivgeyaersdnadellesfldgfhdestqvqlqlltai
    vklflkkptetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvaakevvlaekpli
    seetdlieptlldelicyigtlasvyhkppnafveg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1w63M (M:)
    msasavyvldlkgkvlicrnyrgdvdmsevehfmpilmekeeegmlspilahggvrfmwi
    khnnlylvatskknacvslvfsflykvvqvfseyfkeleeesirdnfviiyelldelmdf
    gypqttdskilqefitqeghkletgaprppatvtnavswrsegikyrknevfldvieavn
    llvsangnvlrseivgsikmrvflsgmpelrlglndkvlfdntgrgksksveledvkfhq
    cvrlsrfendrtisfippdgefelmsyrlnthvkpliwiesviekhshsrieymvkaksq
    fkrrstannveihipvpndadspkfkttvgsvkwvpenseivwsvksfpggkeylmrahf
    glpsveaedkegkppisvkfeipyfttsgiqvrylkiieksgyqaipwvryitqngdyql
    rtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63M (M:)
    sasavyvldlkgkvlicrnyrgdvdmsevehfmpilmekeeegmlspilahggvrfmwik
    hnnlylvatskknacvslvfsflykvvqvfseyfkeleeesirdnfviiyelldelmdfg
    ypqttdskilqefitqeghkletgvswrsegikyrknevfldvieavnllvsangnvlrs
    eivgsikmrvflsgmpelrlglndkveledvkfhqcvrlsrfendrtisfippdgefelm
    syrlnthvkpliwiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkf
    kttvgsvkwvpenseivwsvksfpggkeylmrahfglkppisvkfeipyfttsgiqvryl
    kiieksgyqaipwvryitqngdyqlrtq
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1w63N (N:)
    msasavyvldlkgkvlicrnyrgdvdmsevehfmpilmekeeegmlspilahggvrfmwi
    khnnlylvatskknacvslvfsflykvvqvfseyfkeleeesirdnfviiyelldelmdf
    gypqttdskilqefitqeghkletgaprppatvtnavswrsegikyrknevfldvieavn
    llvsangnvlrseivgsikmrvflsgmpelrlglndkvlfdntgrgksksveledvkfhq
    cvrlsrfendrtisfippdgefelmsyrlnthvkpliwiesviekhshsrieymvkaksq
    fkrrstannveihipvpndadspkfkttvgsvkwvpenseivwsvksfpggkeylmrahf
    glpsveaedkegkppisvkfeipyfttsgiqvrylkiieksgyqaipwvryitqngdyql
    rtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63N (N:)
    sasavyvldlkgkvlicrnyrgdvdmsevehfmpilmekeeegmlspilahggvrfmwik
    hnnlylvatskknacvslvfsflykvvqvfseyfkeleeesirdnfviiyelldelmdfg
    ypqttdskilqefitqeghkletgvswrsegikyrknevfldvieavnllvsangnvlrs
    eivgsikmrvflsgmpelrlglndkveledvkfhqcvrlsrfendrtisfippdgefelm
    syrlnthvkpliwiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkf
    kttvgsvkwvpenseivwsvksfpggkeylmrahfglkppisvkfeipyfttsgiqvryl
    kiieksgyqaipwvryitqngdyqlrtq
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1w63O (O:)
    msasavyvldlkgkvlicrnyrgdvdmsevehfmpilmekeeegmlspilahggvrfmwi
    khnnlylvatskknacvslvfsflykvvqvfseyfkeleeesirdnfviiyelldelmdf
    gypqttdskilqefitqeghkletgaprppatvtnavswrsegikyrknevfldvieavn
    llvsangnvlrseivgsikmrvflsgmpelrlglndkvlfdntgrgksksveledvkfhq
    cvrlsrfendrtisfippdgefelmsyrlnthvkpliwiesviekhshsrieymvkaksq
    fkrrstannveihipvpndadspkfkttvgsvkwvpenseivwsvksfpggkeylmrahf
    glpsveaedkegkppisvkfeipyfttsgiqvrylkiieksgyqaipwvryitqngdyql
    rtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63O (O:)
    sasavyvldlkgkvlicrnyrgdvdmsevehfmpilmekeeegmlspilahggvrfmwik
    hnnlylvatskknacvslvfsflykvvqvfseyfkeleeesirdnfviiyelldelmdfg
    ypqttdskilqefitqeghkletgvswrsegikyrknevfldvieavnllvsangnvlrs
    eivgsikmrvflsgmpelrlglndkveledvkfhqcvrlsrfendrtisfippdgefelm
    syrlnthvkpliwiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkf
    kttvgsvkwvpenseivwsvksfpggkeylmrahfglkppisvkfeipyfttsgiqvryl
    kiieksgyqaipwvryitqngdyqlrtq
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1w63P (P:)
    msasavyvldlkgkvlicrnyrgdvdmsevehfmpilmekeeegmlspilahggvrfmwi
    khnnlylvatskknacvslvfsflykvvqvfseyfkeleeesirdnfviiyelldelmdf
    gypqttdskilqefitqeghkletgaprppatvtnavswrsegikyrknevfldvieavn
    llvsangnvlrseivgsikmrvflsgmpelrlglndkvlfdntgrgksksveledvkfhq
    cvrlsrfendrtisfippdgefelmsyrlnthvkpliwiesviekhshsrieymvkaksq
    fkrrstannveihipvpndadspkfkttvgsvkwvpenseivwsvksfpggkeylmrahf
    glpsveaedkegkppisvkfeipyfttsgiqvrylkiieksgyqaipwvryitqngdyql
    rtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63P (P:)
    sasavyvldlkgkvlicrnyrgdvdmsevehfmpilmekeeegmlspilahggvrfmwik
    hnnlylvatskknacvslvfsflykvvqvfseyfkeleeesirdnfviiyelldelmdfg
    ypqttdskilqefitqeghkletgvswrsegikyrknevfldvieavnllvsangnvlrs
    eivgsikmrvflsgmpelrlglndkveledvkfhqcvrlsrfendrtisfippdgefelm
    syrlnthvkpliwiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkf
    kttvgsvkwvpenseivwsvksfpggkeylmrahfglkppisvkfeipyfttsgiqvryl
    kiieksgyqaipwvryitqngdyqlrtq
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1w63Q (Q:)
    mmrfmllfsrqgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
    ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
    gdvqdtskksvlkaieqadllqeedesprsvleemgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63Q (Q:)
    mmrfmllfsrqgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
    ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
    gdvqdtskksvlkaieqadllqeedespr
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1w63R (R:)
    msasavyvldlkgkvlicrnyrgdvdmsevehfmpilmekeeegmlspilahggvrfmwi
    khnnlylvatskknacvslvfsflykvvqvfseyfkeleeesirdnfviiyelldelmdf
    gypqttdskilqefitqeghkletgaprppatvtnavswrsegikyrknevfldvieavn
    llvsangnvlrseivgsikmrvflsgmpelrlglndkvlfdntgrgksksveledvkfhq
    cvrlsrfendrtisfippdgefelmsyrlnthvkpliwiesviekhshsrieymvkaksq
    fkrrstannveihipvpndadspkfkttvgsvkwvpenseivwsvksfpggkeylmrahf
    glpsveaedkegkppisvkfeipyfttsgiqvrylkiieksgyqaipwvryitqngdyql
    rtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63R (R:)
    sasavyvldlkgkvlicrnyrgdvdmsevehfmpilmekeeegmlspilahggvrfmwik
    hnnlylvatskknacvslvfsflykvvqvfseyfkeleeesirdnfviiyelldelmdfg
    ypqttdskilqefitqeghkletgvswrsegikyrknevfldvieavnllvsangnvlrs
    eivgsikmrvflsgmpelrlglndkveledvkfhqcvrlsrfendrtisfippdgefelm
    syrlnthvkpliwiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkf
    kttvgsvkwvpenseivwsvksfpggkeylmrahfglkppisvkfeipyfttsgiqvryl
    kiieksgyqaipwvryitqngdyqlrtq
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1w63S (S:)
    mmrfmllfsrqgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
    ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
    gdvqdtskksvlkaieqadllqeedesprsvleemgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63S (S:)
    mmrfmllfsrqgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
    ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
    gdvqdtskksvlkaieqadllqeedespr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1w63T (T:)
    mmrfmllfsrqgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
    ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
    gdvqdtskksvlkaieqadllqeedesprsvleemgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63T (T:)
    mmrfmllfsrqgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
    ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
    gdvqdtskksvlkaieqadllqeedespr
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1w63U (U:)
    mmrfmllfsrqgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
    ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
    gdvqdtskksvlkaieqadllqeedesprsvleemgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63U (U:)
    mmrfmllfsrqgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
    ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
    gdvqdtskksvlkaieqadllqeedespr
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1w63V (V:)
    msasavyvldlkgkvlicrnyrgdvdmsevehfmpilmekeeegmlspilahggvrfmwi
    khnnlylvatskknacvslvfsflykvvqvfseyfkeleeesirdnfviiyelldelmdf
    gypqttdskilqefitqeghkletgaprppatvtnavswrsegikyrknevfldvieavn
    llvsangnvlrseivgsikmrvflsgmpelrlglndkvlfdntgrgksksveledvkfhq
    cvrlsrfendrtisfippdgefelmsyrlnthvkpliwiesviekhshsrieymvkaksq
    fkrrstannveihipvpndadspkfkttvgsvkwvpenseivwsvksfpggkeylmrahf
    glpsveaedkegkppisvkfeipyfttsgiqvrylkiieksgyqaipwvryitqngdyql
    rtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63V (V:)
    sasavyvldlkgkvlicrnyrgdvdmsevehfmpilmekeeegmlspilahggvrfmwik
    hnnlylvatskknacvslvfsflykvvqvfseyfkeleeesirdnfviiyelldelmdfg
    ypqttdskilqefitqeghkletgvswrsegikyrknevfldvieavnllvsangnvlrs
    eivgsikmrvflsgmpelrlglndkveledvkfhqcvrlsrfendrtisfippdgefelm
    syrlnthvkpliwiesviekhshsrieymvkaksqfkrrstannveihipvpndadspkf
    kttvgsvkwvpenseivwsvksfpggkeylmrahfglkppisvkfeipyfttsgiqvryl
    kiieksgyqaipwvryitqngdyqlrtq
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1w63W (W:)
    mmrfmllfsrqgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
    ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
    gdvqdtskksvlkaieqadllqeedesprsvleemgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63W (W:)
    mmrfmllfsrqgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
    ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
    gdvqdtskksvlkaieqadllqeedespr
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1w63X (X:)
    mmrfmllfsrqgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
    ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
    gdvqdtskksvlkaieqadllqeedesprsvleemgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w63X (X:)
    mmrfmllfsrqgklrlqkwylatsdkerkkmvrelmqvvlarkpkmcsflewrdlkvvyk
    ryaslyfccaiegqdnelitlelihryvelldkyfgsvceldiifnfekayfildeflmg
    gdvqdtskksvlkaieqadllqeedespr