PDB entry 1w62

View 1w62 on RCSB PDB site
Description: proline racemase in complex with one molecule of pyrrole-2-carboxylic acid (hemi form)
Class: racemase
Keywords: racemase, racemase pyridoxal phosphate-independent, stereo inversion, b-cell mitogen, homodimer, alpha/beta domains
Deposited on 2004-08-12, released 2006-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.177
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: b-cell mitogen
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W62 (393-End)
    • Uniprot Q9NCP4 (Start-392)
    • Uniprot 1W62
    Domains in SCOPe 2.07: d1w62a_
  • Chain 'B':
    Compound: b-cell mitogen
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W62 (393-End)
    • Uniprot Q9NCP4 (Start-392)
    • Uniprot 1W62
    Domains in SCOPe 2.07: d1w62b_
  • Heterogens: PYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w62A (A:)
    mgqekllfdqkykiikgekkekkknqranrrehqqkreimrfkksftcidmhtegeaari
    vtsglphipgsnmaekkaylqenmdylrrgimleprghddmfgaflfdpieegadlgivf
    mdtggylnmcghnsiaavtaavetgivsvpakatnvpvvldtpaglvrgtahlqsgtese
    vsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnffaivpaeqlgidisvqnlsrl
    qeagellrteinrsvkvqhpqlphintvdcveiygpptnpeanyknvvifgnrqadrspc
    gtgtsakmatlyakgqlrigetfvyesilgslfqgrvlgeeripgvkvpvtkdaeegmlv
    vtaeitgkafimgfntmlfdptdpfkngftlkqyiwsssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w62A (A:)
    hqqkreimrfkksftcidmhtegeaarivtsglphipgsnmaekkaylqenmdylrrgim
    leprghddmfgaflfdpieegadlgivfmdtggylnmcghnsiaavtaavetgivsvpak
    atnvpvvldtpaglvrgtahlqsgtesevsnasiinvpsflyqqdvvvvlpkpygevrvd
    iafggnffaivpaeqlgidisvqnlsrlqeagellrteinrsvkvqhpqlphintvdcve
    iygpptnpeanyknvvifgnrqadrspcgtgtsakmatlyakgqlrigetfvyesilgsl
    fqgrvlgeeripgvkvpvtkdaeegmlvvtaeitgkafimgfntmlfdptdpfkngftlk
    qy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w62B (B:)
    mgqekllfdqkykiikgekkekkknqranrrehqqkreimrfkksftcidmhtegeaari
    vtsglphipgsnmaekkaylqenmdylrrgimleprghddmfgaflfdpieegadlgivf
    mdtggylnmcghnsiaavtaavetgivsvpakatnvpvvldtpaglvrgtahlqsgtese
    vsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnffaivpaeqlgidisvqnlsrl
    qeagellrteinrsvkvqhpqlphintvdcveiygpptnpeanyknvvifgnrqadrspc
    gtgtsakmatlyakgqlrigetfvyesilgslfqgrvlgeeripgvkvpvtkdaeegmlv
    vtaeitgkafimgfntmlfdptdpfkngftlkqyiwsssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w62B (B:)
    ksftcidmhtegeaarivtsglphipgsnmaekkaylqenmdylrrgimleprghddmfg
    aflfdpieegadlgivfmdtggylnmcghnsiaavtaavetgivsvpakatnvpvvldtp
    aglvrgtahlqsgtesevsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnffaiv
    paeqlgidisvqnlsrlqeagellrteinrsvkvqhpqlphintvdcveiygpptnpean
    yknvvifgnrqadrspcgtgtsakmatlyakgqlrigetfvyesilgslfqgrvlgeeri
    pgvkvpvtkdaeegmlvvtaeitgkafimgfntmlfdptdpfkngftlkqy