PDB entry 1w61

View 1w61 on RCSB PDB site
Description: proline racemase in complex with 2 molecules of pyrrole-2-carboxylic acid (holo form)
Class: racemase
Keywords: racemase, racemase pyridoxal phosphate-independent, stereo inversion, b-cell mitogen, acid/base catalysis, homodimer, alpha/beta domains
Deposited on 2004-08-11, released 2006-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.15
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: b-cell mitogen
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W61 (393-End)
    • Uniprot Q9NCP4 (Start-392)
    Domains in SCOPe 2.07: d1w61a_
  • Chain 'B':
    Compound: b-cell mitogen
    Species: TRYPANOSOMA CRUZI [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W61 (393-End)
    • Uniprot Q9NCP4 (Start-392)
    Domains in SCOPe 2.07: d1w61b1, d1w61b2
  • Heterogens: PYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w61A (A:)
    mgqekllfdqkykiikgekkekkknqranrrehqqkreimrfkksftcidmhtegeaari
    vtsglphipgsnmaekkaylqenmdylrrgimleprghddmfgaflfdpieegadlgivf
    mdtggylnmcghnsiaavtaavetgivsvpakatnvpvvldtpaglvrgtahlqsgtese
    vsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnffaivpaeqlgidisvqnlsrl
    qeagellrteinrsvkvqhpqlphintvdcveiygpptnpeanyknvvifgnrqadrspc
    gtgtsakmatlyakgqlrigetfvyesilgslfqgrvlgeeripgvkvpvtkdaeegmlv
    vtaeitgkafimgfntmlfdptdpfkngftlkqyiwsssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w61A (A:)
    fkksftcidmhtegeaarivtsglphipgsnmaekkaylqenmdylrrgimleprghddm
    fgaflfdpieegadlgivfmdtggylnmcghnsiaavtaavetgivsvpakatnvpvvld
    tpaglvrgtahlqsgtesevsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnffa
    ivpaeqlgidisvqnlsrlqeagellrteinrsvkvqhpqlphintvdcveiygpptnpe
    anyknvvifgnrqadrspcgtgtsakmatlyakgqlrigetfvyesilgslfqgrvlgee
    ripgvkvpvtkdaeegmlvvtaeitgkafimgfntmlfdptdpfkngftlkqy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w61B (B:)
    mgqekllfdqkykiikgekkekkknqranrrehqqkreimrfkksftcidmhtegeaari
    vtsglphipgsnmaekkaylqenmdylrrgimleprghddmfgaflfdpieegadlgivf
    mdtggylnmcghnsiaavtaavetgivsvpakatnvpvvldtpaglvrgtahlqsgtese
    vsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnffaivpaeqlgidisvqnlsrl
    qeagellrteinrsvkvqhpqlphintvdcveiygpptnpeanyknvvifgnrqadrspc
    gtgtsakmatlyakgqlrigetfvyesilgslfqgrvlgeeripgvkvpvtkdaeegmlv
    vtaeitgkafimgfntmlfdptdpfkngftlkqyiwsssvdklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w61B (B:)
    fkksftcidmhtegeaarivtsglphipgsnmaekkaylqenmdylrrgimleprghddm
    fgaflfdpieegadlgivfmdtggylnmcghnsiaavtaavetgivsvpakatnvpvvld
    tpaglvrgtahlqsgtesevsnasiinvpsflyqqdvvvvlpkpygevrvdiafggnffa
    ivpaeqlgidisvqnlsrlqeagellrteinrsvkvqhpqlphintvdcveiygpptnpe
    anyknvvifgnrqadrspcgtgtsakmatlyakgqlrigetfvyesilgslfqgrvlgee
    ripgvkvpvtkdaeegmlvvtaeitgkafimgfntmlfdptdpfkngftlkqyiwss