PDB entry 1w60

View 1w60 on RCSB PDB site
Description: native human pcna
Class: DNA-binding protein
Keywords: DNA, replication, processivity, oncogene, DNA-binding protein, DNA, DNA replication, DNA-binding systemic lupus erythematosus
Deposited on 2004-08-11, released 2005-01-13
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.19695
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proliferating Cell Nuclear Antigen
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w60a1, d1w60a2
  • Chain 'B':
    Compound: Proliferating Cell Nuclear Antigen
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1w60b1, d1w60b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w60A (A:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w60A (A:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w60B (B:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapkiedeegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w60B (B:)
    mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
    rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
    ldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngni
    klsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveyk
    iadmghlkyylapki