PDB entry 1w5t

View 1w5t on RCSB PDB site
Description: structure of the aeropyrum pernix orc2 protein (adpnp-ADP complexes)
Class: DNA replication initiation
Keywords: orc, cdc6, DNA replication initiation, DNA binding protein, aaa+ ATPase
Deposited on 2004-08-09, released 2004-10-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orc2
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1w5ta1, d1w5ta2
  • Chain 'B':
    Compound: orc2
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1w5tb1, d1w5tb2
  • Chain 'C':
    Compound: orc2
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1w5tc1, d1w5tc2
  • Heterogens: ANP, MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w5tA (A:)
    mkvlrhglfkdrrvfdenyippelrvrrgeaealariylnrllsgaglsdvnmiygsigr
    vgigkttlakftvkrvseaaakegltvkqayvnafnapnlytilslivrqtgypiqvrga
    paldilkalvdnlyvenhyllvildefqsmlsspriaaedlytllrvheeipsrdgvnri
    gfllvasdvralsymrekipqvesqigfklhlpayksrelytileqraelglrdtvwepr
    hlelisdvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavseneaasiqt
    helealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiylk
    hltslglvdakpsgrgmrgrttlfrlaphlpadrlievvdniiqakmasgye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5tA (A:)
    glfkdrrvfdenyippelrvrrgeaealariylnrllsgaglsdvnmiygsigrvgigkt
    tlakftvkrvseaaakegltvkqayvnafnapnlytilslivrqtgypiqvrgapaldil
    kalvdnlyvenhyllvildefqsmlsspriaaedlytllrvheeipsrdgvnrigfllva
    sdvralsymrekipqvesqigfklhlpayksrelytileqraelglrdtvweprhlelis
    dvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavsenasiqthelealsi
    heliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiylkhltslglv
    dakpsttlfrlaphlpadrlievvdniiqakmasg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w5tB (B:)
    mkvlrhglfkdrrvfdenyippelrvrrgeaealariylnrllsgaglsdvnmiygsigr
    vgigkttlakftvkrvseaaakegltvkqayvnafnapnlytilslivrqtgypiqvrga
    paldilkalvdnlyvenhyllvildefqsmlsspriaaedlytllrvheeipsrdgvnri
    gfllvasdvralsymrekipqvesqigfklhlpayksrelytileqraelglrdtvwepr
    hlelisdvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavseneaasiqt
    helealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiylk
    hltslglvdakpsgrgmrgrttlfrlaphlpadrlievvdniiqakmasgye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5tB (B:)
    glfkdrrvfdenyippelrvrrgeaealariylnrllsgaglsdvnmiygsigrvgigkt
    tlakftvkrvseaaakegltvkqayvnafnapnlytilslivrqtgypiqvrgapaldil
    kalvdnlyvenhyllvildefqsmlsspriaaedlytllrvheeipsrdgvnrigfllva
    sdvralsymrekipqvesqigfklhlpayksrelytileqraelglrdtvweprhlelis
    dvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavseneaasiqtheleal
    siheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiylkhltslg
    lvdakpsttlfrlaphlpadrlievvdniiqakmasg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w5tC (C:)
    mkvlrhglfkdrrvfdenyippelrvrrgeaealariylnrllsgaglsdvnmiygsigr
    vgigkttlakftvkrvseaaakegltvkqayvnafnapnlytilslivrqtgypiqvrga
    paldilkalvdnlyvenhyllvildefqsmlsspriaaedlytllrvheeipsrdgvnri
    gfllvasdvralsymrekipqvesqigfklhlpayksrelytileqraelglrdtvwepr
    hlelisdvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavseneaasiqt
    helealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiylk
    hltslglvdakpsgrgmrgrttlfrlaphlpadrlievvdniiqakmasgye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5tC (C:)
    glfkdrrvfdenyippelrvrrgeaealariylnrllsgaglsdvnmiygsigrvgigkt
    tlakftvkrvseaaakegltvkqayvnafnapnlytilslivrqtgypiqvrgapaldil
    kalvdnlyvenhyllvildefqsmlsspriaaedlytllrvheeipsrdgvnrigfllva
    sdvralsymrekipqvesqigfklhlpayksrelytileqraelglrdtvweprhlelis
    dvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavseneiqthelealsih
    eliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiylkhltslglvd
    akpsttlfrlaphlpadrlievvdniiqakmasg