PDB entry 1w5s

View 1w5s on RCSB PDB site
Description: structure of the aeropyrum pernix orc2 protein (ADP form)
Class: replication
Keywords: replication, orc, cdc6, DNA replication initiation, DNA binding protein, aaa+ ATPase
Deposited on 2004-08-09, released 2004-10-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.216
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: origin recognition complex subunit 2 orc2
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1w5sa1, d1w5sa2
  • Chain 'B':
    Compound: origin recognition complex subunit 2 orc2
    Species: Aeropyrum pernix [TaxId:56636]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1w5sb1, d1w5sb2
  • Heterogens: SO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w5sA (A:)
    mkvlrhglfkdrrvfdenyippelrvrrgeaealariylnrllsgaglsdvnmiygsigr
    vgigkttlakftvkrvseaaakegltvkqayvnafnapnlytilslivrqtgypiqvrga
    paldilkalvdnlyvenhyllvildefqsmlsspriaaedlytllrvheeipsrdgvnri
    gfllvasdvralsymrekipqvesqigfklhlpayksrelytileqraelglrdtvwepr
    hlelisdvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavseneaasiqt
    helealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiylk
    hltslglvdakpsgrgmrgrttlfrlaphlpadrlievvdniiqakmasgye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5sA (A:)
    glfkdrrvfdenyippelrvrrgeaealariylnrllsgaglsdvnmiygsigrvgigkt
    tlakftvkrvseaaakegltvkqayvnafnapnlytilslivrqtgypiqvrgapaldil
    kalvdnlyvenhyllvildefqsmlsspriaaedlytllrvheeipsrdgvnrigfllva
    sdvralsymrekipqvesqigfklhlpayksrelytileqraelglrdtvweprhlelis
    dvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavsenthelealsiheli
    ilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiylkhltslglvdakp
    sttlfrlaphlpadrlievvdniiqakmas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w5sB (B:)
    mkvlrhglfkdrrvfdenyippelrvrrgeaealariylnrllsgaglsdvnmiygsigr
    vgigkttlakftvkrvseaaakegltvkqayvnafnapnlytilslivrqtgypiqvrga
    paldilkalvdnlyvenhyllvildefqsmlsspriaaedlytllrvheeipsrdgvnri
    gfllvasdvralsymrekipqvesqigfklhlpayksrelytileqraelglrdtvwepr
    hlelisdvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavseneaasiqt
    helealsiheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiylk
    hltslglvdakpsgrgmrgrttlfrlaphlpadrlievvdniiqakmasgye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5sB (B:)
    glfkdrrvfdenyippelrvrrgeaealariylnrllsgaglsdvnmiygsigrvgigkt
    tlakftvkrvseaaakegltvkqayvnafnapnlytilslivrqtgypiqvrgapaldil
    kalvdnlyvenhyllvildefqsmlsspriaaedlytllrvheeipsrdgvnrigfllva
    sdvralsymrekipqvesqigfklhlpayksrelytileqraelglrdtvweprhlelis
    dvygedkggdgsarraivalkmacemaeamgrdslsedlvrkavseneaasiqtheleal
    siheliilrliaeatlggmewinagllrqryedasltmynvkprgytqyhiylkhltslg
    lvdakpsttlfrlaphlpadrlievvdniiqakmas