PDB entry 1w5r

View 1w5r on RCSB PDB site
Description: x-ray crystallographic strcuture of a c70q mycobacterium smegmatis n-arylamine acetyltransferase
Class: transferase
Keywords: transferase, acyltransferase
Deposited on 2004-08-09, released 2005-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.197
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arylamine n-acetyltransferase
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W5R
      • engineered mutation (72)
    • Uniprot O86309 (Start-277)
    Domains in SCOPe 2.07: d1w5ra1
  • Chain 'B':
    Compound: arylamine n-acetyltransferase
    Species: Mycobacterium smegmatis [TaxId:1772]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W5R
      • engineered mutation (72)
    • Uniprot O86309 (Start-277)
    Domains in SCOPe 2.07: d1w5rb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w5rA (A:)
    eshmamdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaeal
    faklvdrrrggyqyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvav
    pgadgrylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqply
    tftteprpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehi
    rfdsaaqvldaivnrfgidlgdlagrdvqarvaevldt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5rA (A:)
    mdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfaklv
    drrrggyqyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgadg
    rylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytftte
    prpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfdsa
    aqvldaivnrfgidlgdlagrdvqarvaevldt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w5rB (B:)
    eshmamdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaeal
    faklvdrrrggyqyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvav
    pgadgrylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqply
    tftteprpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehi
    rfdsaaqvldaivnrfgidlgdlagrdvqarvaevldt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5rB (B:)
    mdlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfaklv
    drrrggyqyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgadg
    rylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytftte
    prpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfdsa
    aqvldaivnrfgidlgdlagrdvqarvaevldt