PDB entry 1w5m

View 1w5m on RCSB PDB site
Description: stepwise introduction of zinc binding site into porphobilinogen synthase of pseudomonas aeruginosa (mutations a129c and d139c)
Class: synthase
Keywords: synthase, evolution, metalloenzyme, porphobilinogen synthase, pseudomonas aeruginosa, protein engineering,
Deposited on 2004-08-09, released 2005-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.131
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-aminolevulinic acid dehydratase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59643
      • engineered mutation (128)
      • engineered mutation (138)
      • see remark 999 (198)
    Domains in SCOPe 2.07: d1w5ma_
  • Chain 'B':
    Compound: delta-aminolevulinic acid dehydratase
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59643
      • engineered mutation (128)
      • engineered mutation (138)
      • see remark 999 (198)
    Domains in SCOPe 2.07: d1w5mb_
  • Heterogens: CL, FMT, MG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w5mA (A:)
    msftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgv
    erlsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfp
    elgiitdvcldpftthgqcgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdg
    rigairealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansd
    ealhevaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngw
    laesvilesltafkragadgiltyfakqaaeqlrrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5mA (A:)
    nraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsid
    qllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgiit
    dvcldpftthgqcgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigair
    ealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdealhev
    aadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvi
    lesltafkragadgiltyfakqaaeqlrrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w5mB (B:)
    msftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgv
    erlsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfp
    elgiitdvcldpftthgqcgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdg
    rigairealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansd
    ealhevaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngw
    laesvilesltafkragadgiltyfakqaaeqlrrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5mB (B:)
    anraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsi
    dqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgii
    tdvcldpftthgqcgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigai
    realesaghtnvrvmaysakyasayygpfrdavgsnkatyqmdpansdealhevaadlae
    gadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvileslta
    fkragadgiltyfakqaaeqlrrg