PDB entry 1w5e

View 1w5e on RCSB PDB site
Description: ftsz w319y mutant, p1 (m. jannaschii)
Class: cell division
Keywords: cell division, cell-division protein, complete proteome, GTP-binding, multigene family, septation, tubulin, ftsz, filament, z-ring, gtpase
Deposited on 2004-08-06, released 2004-12-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2638
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ftsz
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57816
      • engineered mutation (318)
    Domains in SCOPe 2.06: d1w5ea1, d1w5ea2
  • Chain 'B':
    Compound: ftsz
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57816
      • engineered mutation (318)
    Domains in SCOPe 2.06: d1w5eb1, d1w5eb2
  • Chain 'C':
    Compound: ftsz
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57816
      • engineered mutation (318)
    Domains in SCOPe 2.06: d1w5ec1, d1w5ec2
  • Chain 'D':
    Compound: ftsz
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57816
      • engineered mutation (318)
    Domains in SCOPe 2.06: d1w5ed1, d1w5ed2
  • Chain 'E':
    Compound: ftsz
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57816
      • engineered mutation (318)
    Domains in SCOPe 2.06: d1w5ee1, d1w5ee2
  • Chain 'F':
    Compound: ftsz
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57816
      • engineered mutation (318)
    Domains in SCOPe 2.06: d1w5ef1, d1w5ef2
  • Chain 'G':
    Compound: ftsz
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57816
      • engineered mutation (318)
    Domains in SCOPe 2.06: d1w5eg1, d1w5eg2
  • Chain 'H':
    Compound: ftsz
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57816
      • engineered mutation (318)
    Domains in SCOPe 2.06: d1w5eh1, d1w5eh2
  • Chain 'I':
    Compound: ftsz
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57816
      • engineered mutation (318)
    Domains in SCOPe 2.06: d1w5ei1, d1w5ei2
  • Heterogens: GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w5eA (A:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eA (A:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w5eB (B:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eB (B:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w5eC (C:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eC (C:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w5eD (D:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eD (D:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w5eE (E:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eE (E:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w5eF (F:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eF (F:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w5eG (G:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eG (G:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1w5eH (H:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eH (H:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrkk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1w5eI (I:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eI (I:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrk