PDB entry 1w5e

View 1w5e on RCSB PDB site
Description: ftsz w319y mutant, p1 (m. jannaschii)
Deposited on 2004-08-06, released 2004-12-01
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-01, with a file datestamp of 2004-12-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.2638
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w5eA (A:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eA (A:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w5eB (B:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eB (B:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrkk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w5eC (C:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eC (C:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w5eD (D:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eD (D:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w5eE (E:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eE (E:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrkk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w5eF (F:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eF (F:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w5eG (G:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eG (G:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1w5eH (H:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eH (H:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrkk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1w5eI (I:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiygatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5eI (I:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiygat
    idenlentvrvllvitgvqsrieftdtglkrk