PDB entry 1w5c

View 1w5c on RCSB PDB site
Description: Photosystem II from Thermosynechococcus elongatus
Class: photosynthesis
Keywords: photosynthesis, water oxidation, photosystem, membrane protein
Deposited on 2004-08-06, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: photosystem q(b) protein 1
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w5ca_
  • Chain 'B':
    Compound: Photosystem II core light harvesting protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w5cb_
  • Chain 'C':
    Compound: Photosystem II CP43 protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w5cc_
  • Chain 'D':
    Compound: Photosystem II reaction center D2 protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w5cd_
  • Chain 'E':
    Compound: cytochrome b559 alpha subunit
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W5C
    • Uniprot P12238 (Start-83)
    Domains in SCOPe 2.07: d1w5ce_
  • Chain 'F':
    Compound: cytochrome b559 beta subunit
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w5cf_
  • Chain 'G':
    Compound: photosystem q(b) protein 1
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w5cg_
  • Chain 'H':
    Compound: Photosystem II core light harvesting protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w5ch_
  • Chain 'I':
    Compound: Photosystem II CP43 protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w5ci_
  • Chain 'J':
    Compound: Photosystem II reaction center D2 protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w5cj_
  • Chain 'K':
    Compound: cytochrome b559 alpha subunit
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W5C
    • Uniprot P12238 (Start-83)
    Domains in SCOPe 2.07: d1w5ck_
  • Chain 'L':
    Compound: cytochrome b559 beta subunit
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w5cl_
  • Chain 'O':
    Compound: Photosystem II manganese-stabilizing polypeptide
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W5C (0-178)
  • Chain 'P':
    Compound: Photosystem II manganese-stabilizing polypeptide
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W5C (0-178)
  • Chain 'S':
    Compound: Photosystem II 12 kDa extrinsic protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W5C (0-99)
  • Chain 'T':
    Compound: cytochrome c-550
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w5ct_
  • Chain 'U':
    Compound: Photosystem II 12 kDa extrinsic protein
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W5C (0-99)
  • Chain 'V':
    Compound: cytochrome c-550
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w5cv_
  • Chain 'X':
    Compound: unassigned subunits
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W5C (0-358)
  • Chain 'Y':
    Compound: unassigned subunits
    Species: Thermosynechococcus elongatus [TaxId:146786]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W5C (0-358)
  • Heterogens: CLA, PHO, MN, FE2, PL9, HEM, BCR, HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w5cA (A:)
    mtttlqrresanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdi
    dgirepvsgsllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfl
    lgascymgrqwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtf
    nfmivfqaehnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfg
    qeeetynivaahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngf
    nfnhsvidakgnvintwadiinranlgmevmhernahnfpldlasaesapvamiapsing
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cA (A:)
    resanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepv
    sgsllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascym
    grqwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfq
    aehnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesygykfgqeeetyniv
    aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida
    kgnvintwadiinranlgmevmhernahnfpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w5cB (B:)
    mglpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgm
    fvlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdl
    elfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqp
    vapewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlss
    siaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatlee
    awsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmp
    affesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksy
    arkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfs
    gidpelspeqvewgfyqkvgdvttrrkeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cB (B:)
    glpwrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmfv
    lpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdlel
    frdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpva
    pewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsssi
    aavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleeaw
    saipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpaf
    fesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksyar
    kaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w5cC (C:)
    mktlssqkryspvvtlssnsifatnrdqessgfawwagnarlinlsgkllgahvahagli
    vfwagamtlfelahfipekpmyeqgliliphiatlgwgvgpggevvdtfpffvvgvvhli
    ssavlgfggvyhairgpetleeyssffgydwkdknkmttilgfhlivlgigalllvakam
    ffgglydtwapgggdvrvitnptldprvifgyllkspfggegwivsvnnledvvgghiwi
    gliciaggiwhilttpfgwarrafiwsgeaylsyslgalsmmgfiatcfvwfnntvypse
    fygptgpeasqaqamtflirdqklganvgsaqgptglgkylmrsptgeiifggetmrfwd
    frgpwleplrgpngldlnkikndiqpwqerraaeymthaplgslnsvggvateinsvnfv
    sprswlatshfvlaffflvghlwhagraraaaagfekgidresepvlsmpsld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cC (C:)
    ifatnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekp
    myeqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetl
    eeyssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvit
    nptldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwa
    rrafiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflir
    dqklganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnki
    kndiqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvg
    hlwhagraraaaagfekg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w5cD (D:)
    mtiaigrapaergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswyt
    hglassylegcnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgaf
    gligfmlrqfeiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifr
    fllffqgfhnwtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqa
    eetysmvtanrfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfis
    qeiraaedpefetfytknlllnegirawmapqdqphenfvfpeevlprgnal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cD (D:)
    mtiaigrapaergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswyt
    hglassylegcnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgaf
    gligfmlrqfeiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifr
    fllffqgfhnwtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqa
    eetysmvtanrfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfis
    qeiraaedpefetfytknlllnegirawmapqdqphenfvfpeevlprgn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w5cE (E:)
    magttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeq
    rsiplvtdrfeakqqvetfleqlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cE (E:)
    rpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsiplvt
    drfakqqvetfleqlk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w5cF (F:)
    tsntpnqepvsypiftvrwvavhtlavptifflgaiaamqfiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cF (F:)
    epvsypiftvrwvavhtlavptifflgaiaamqfiqr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1w5cG (G:)
    mtttlqrresanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdi
    dgirepvsgsllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfl
    lgascymgrqwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtf
    nfmivfqaehnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesanygykfg
    qeeetynivaahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngf
    nfnhsvidakgnvintwadiinranlgmevmhernahnfpldlasaesapvamiapsing
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cG (G:)
    resanlwerfcnwvtstdnrlyvgwfgvimiptllaaticfviafiaappvdidgirepv
    sgsllygnniitgavvpssnaiglhfypiweaasldewlynggpyqliifhfllgascym
    grqwelsyrlgmrpwicvaysaplasafavfliypigqgsfsdgmplgisgtfnfmivfq
    aehnilmhpfhqlgvagvfggalfcamhgslvtsslirettetesygykfgqeeetyniv
    aahgyfgrlifqyasfnnsrslhfflaawpvvgvwftalgistmafnlngfnfnhsvida
    kgnvintwadiinranlgmevmhernahnfpl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1w5cH (H:)
    mglpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgm
    fvlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdl
    elfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqp
    vapewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlss
    siaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatlee
    awsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmp
    affesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksy
    arkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfs
    gidpelspeqvewgfyqkvgdvttrrkeav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cH (H:)
    lpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmfv
    lpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdlel
    frdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpva
    pewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsssi
    aavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleeaw
    saipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpaf
    fesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksyar
    kaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1w5cI (I:)
    mktlssqkryspvvtlssnsifatnrdqessgfawwagnarlinlsgkllgahvahagli
    vfwagamtlfelahfipekpmyeqgliliphiatlgwgvgpggevvdtfpffvvgvvhli
    ssavlgfggvyhairgpetleeyssffgydwkdknkmttilgfhlivlgigalllvakam
    ffgglydtwapgggdvrvitnptldprvifgyllkspfggegwivsvnnledvvgghiwi
    gliciaggiwhilttpfgwarrafiwsgeaylsyslgalsmmgfiatcfvwfnntvypse
    fygptgpeasqaqamtflirdqklganvgsaqgptglgkylmrsptgeiifggetmrfwd
    frgpwleplrgpngldlnkikndiqpwqerraaeymthaplgslnsvggvateinsvnfv
    sprswlatshfvlaffflvghlwhagraraaaagfekgidresepvlsmpsld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cI (I:)
    ifatnrdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekp
    myeqgliliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetl
    eeyssffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvit
    nptldprvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwa
    rrafiwsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflir
    dqklganvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnki
    kndiqpwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvg
    hlwhagraraaaagfekg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1w5cJ (J:)
    mtiaigrapaergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswyt
    hglassylegcnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgaf
    gligfmlrqfeiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifr
    fllffqgfhnwtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqa
    eetysmvtanrfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfis
    qeiraaedpefetfytknlllnegirawmapqdqphenfvfpeevlprgnal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cJ (J:)
    mtiaigrapaergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswyt
    hglassylegcnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgaf
    gligfmlrqfeiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifr
    fllffqgfhnwtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqa
    eetysmvtanrfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfis
    qeiraaedpefetfytknlllnegirawmapqdqphenfvfpeevlprgn
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1w5cK (K:)
    magttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeq
    rsiplvtdrfeakqqvetfleqlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cK (K:)
    rpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsiplvt
    drfakqqvetfleqlk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1w5cL (L:)
    tsntpnqepvsypiftvrwvavhtlavptifflgaiaamqfiqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cL (L:)
    epvsypiftvrwvavhtlavptifflgaiaamqfiqr
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1w5cT (T:)
    mlkkcvwlavalclclwqftmgtalaaeltpevltvplnsegktitltekqylegkrlfq
    yacaschvggitktnpsldlrtetlalatpprdnieglvdymknpttydgeqeiaevhps
    lrsadifpkmrnltekdlvaiaghilvepkilgdkwgggkvyy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cT (T:)
    eltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetlal
    atpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghilv
    epkilgdkwgggkvyy
    

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1w5cV (V:)
    mlkkcvwlavalclclwqftmgtalaaeltpevltvplnsegktitltekqylegkrlfq
    yacaschvggitktnpsldlrtetlalatpprdnieglvdymknpttydgeqeiaevhps
    lrsadifpkmrnltekdlvaiaghilvepkilgdkwgggkvyy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5cV (V:)
    eltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetlal
    atpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghilv
    epkilgdkwgggkvyy
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.