PDB entry 1w5b

View 1w5b on RCSB PDB site
Description: ftsz dimer, gtp soak (m. jannaschii)
Deposited on 2004-08-06, released 2004-12-01
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-01, with a file datestamp of 2004-12-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w5bA (A:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5bA (A:)
    lspedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtka
    dkkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsap
    vvaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpn
    mplklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekr
    akeavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiwga
    tidenlentvrvllvitgvqsrieftdtglkrkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w5bB (B:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w5bB (B:)
    lspedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtka
    dkkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsap
    vvaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpn
    mplklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekr
    akeavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiwga
    tidenlentvrvllvitgvqsrieftdtglkrkkle