PDB entry 1w58

View 1w58 on RCSB PDB site
Description: ftsz gmpcpp soak i213 (m. jannaschii)
Class: cell division
Keywords: cell division, cell division protein, cell-division protein, complete proteome, ftsz, GTP-binding, multigene family, septation, tubulin
Deposited on 2004-08-06, released 2004-12-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: cell division protein ftsz homolog 1
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1w5811, d1w5812
  • Heterogens: G2P, MG, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1w581 (1:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w581 (1:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiwgat
    idenlentvrvllvitgvqsrieftdtglkrkkleltg