PDB entry 1w58

View 1w58 on RCSB PDB site
Description: ftsz gmpcpp soak i213 (m. jannaschii)
Deposited on 2004-08-06, released 2004-12-01
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-01, with a file datestamp of 2004-12-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1w581 (1:)
    mkflknvleegskleefnelelspedkelleylqqtkakitvvgcggagnntitrlkmeg
    iegaktvaintdaqqlirtkadkkiligkkltrglgaggnpkigeeaakesaeeikaaiq
    dsdmvfitcglgggtgtgsapvvaeiskkigaltvavvtlpfvmegkvrmknameglerl
    kqhtdtlvvipneklfeivpnmplklafkvadevlinavkglvelitkdglinvdfadvk
    avmnngglamigigesdsekrakeavsmalnsplldvdidgatgalihvmgpedltleea
    revvatvssrldpnatiiwgatidenlentvrvllvitgvqsrieftdtglkrkkleltg
    ipki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w581 (1:)
    spedkelleylqqtkakitvvgcggagnntitrlkmegiegaktvaintdaqqlirtkad
    kkiligkkltrglgaggnpkigeeaakesaeeikaaiqdsdmvfitcglgggtgtgsapv
    vaeiskkigaltvavvtlpfvmegkvrmknameglerlkqhtdtlvvipneklfeivpnm
    plklafkvadevlinavkglvelitkdglinvdfadvkavmnngglamigigesdsekra
    keavsmalnsplldvdidgatgalihvmgpedltleearevvatvssrldpnatiiwgat
    idenlentvrvllvitgvqsrieftdtglkrkkleltg