PDB entry 1w57

View 1w57 on RCSB PDB site
Description: structure of the bifunctional ispdf from campylobacter jejuni containing zn
Deposited on 2004-08-06, released 2004-10-04
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-08, with a file datestamp of 2004-12-08.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: 0.221
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w57A (A:)
    msemslimlaagnstrfntkvkkqflrlgndplwlyatknlssfypfkkivvtssnitym
    kkftknyefieggdtraeslkkalelidsefvmvsdvarvlvsknlfdrlienldkadci
    tpalkvadttlfdnealqrekikliqtpqisktkllkkaldqnleftddstaiaamggki
    wfvegeenarkltfkedlkkldlptpsfeiftgngfdvhefgenrplllagvqihptmgl
    kahsdgdvlahsltdailgaaglgdigelypdtdmkfknansmellkqaydkvreigfel
    inidicvmaqspklkdfkqamqsniahtldldefrinvkattteklgfigrkegmavlss
    vnlkyfdwtrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w57A (A:)
    emslimlaagnstrfntkvkkqflrlgndplwlyatknlssfypfkkivvtssnitymkk
    ftknyefieggdtraeslkkalelidsefvmvsdvarvlvsknlfdrlienldkadcitp
    alkvadttlfdnealqrekikliqtpqisktkllkkaldqnleftddstaiaamggkiwf
    vegeenarkltfkedlkkldlptpsfeiftgngfdvhefgenrplllagvqihptmglka
    hsdgdvlahsltdailgaaglgdigelypdtdmkfknansmellkqaydkvreigfelin
    idicvmaqspklkdfkqamqsniahtldldefrinvkattteklgfigrkegmavlssvn
    lkyfdwtr