PDB entry 1w54

View 1w54 on RCSB PDB site
Description: stepwise introduction of a zinc binding site into porphobilinogen synthase from pseudomonas aeruginosa (mutation d139c)
Class: synthase
Keywords: synthase, evolution, metalloenzyme, porphobilinogen synthase, pseudomonas aeruginosa, protein engineering,
Deposited on 2004-08-05, released 2005-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.157
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-aminolevulinic acid dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59643
      • engineered mutation (138)
      • engineered mutation (198)
    Domains in SCOPe 2.07: d1w54a_
  • Chain 'B':
    Compound: delta-aminolevulinic acid dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59643
      • engineered mutation (138)
      • engineered mutation (198)
    Domains in SCOPe 2.07: d1w54b_
  • Heterogens: FMT, K, MG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w54A (A:)
    msftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgv
    erlsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfp
    elgiitdvaldpftthgqcgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdg
    rigairealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansd
    ealhevaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngw
    laesvilesltafkragadgiltyfakqaaeqlrrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w54A (A:)
    trlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsidqlliea
    eewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgiitdvaldp
    ftthgqcgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigairealesa
    ghtnvrvmaysakyasayygpfrdaatyqmdpansdealhevaadlaegadmvmvkpgmp
    yldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvilesltafkragadgilty
    fakqaaeqlrrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w54B (B:)
    msftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgv
    erlsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfp
    elgiitdvaldpftthgqcgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdg
    rigairealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansd
    ealhevaadlaegadmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngw
    laesvilesltafkragadgiltyfakqaaeqlrrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w54B (B:)
    anraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgverlsi
    dqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpelgii
    tdvaldpftthgqcgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgrigai
    realesaghtnvrvmaysakyasayygpfrdavgsatyqmdpansdealhevaadlaega
    dmvmvkpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvilesltafk
    ragadgiltyfakqaaeqlrrg