PDB entry 1w53

View 1w53 on RCSB PDB site
Description: Kinase recruitment domain of the stress phosphatase RsbU
Class: hydrolase
Keywords: phosphatase, stress, bacillus, kinase, hydrolase
Deposited on 2004-08-05, released 2004-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine phosphatase rsbu
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w53a_
  • Heterogens: GOL, XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w53A (A:)
    mdfrevieqryhqllsryiaeltetslyqaqkfsrktiehqippeeiisihrkvlkelyp
    slpedvfhsldflievmigygmay