PDB entry 1w52

View 1w52 on RCSB PDB site
Description: crystal structure of a proteolyzed form of pancreatic lipase related protein 2 from horse
Class: lipase
Keywords: lipase, pancreatic lipase related proteins, detergent, cleaved flap
Deposited on 2004-08-04, released 2006-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.234
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: pancreatic lipase related protein 2
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w52x1, d1w52x2
  • Heterogens: DDQ, CA

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1w52X (X:)
    kevcytplgcfsddkpwagtlqrplkslpwspeevntrfllytnknpdsyqlitardvat
    ikssnfqssrkthfvihgfrdrgedswpsdmckkilqvettncisvdwssgakaeytqav
    qnirivgaetayliqqlltelsynpenvhiighslgahtageagrrlegrvgrvtgldpa
    epcfqdaseevrldpsdaqfvdvihtdaspmlpslgfgmsqkvghmdffpnggkqmpgck
    rssfstfidingiwqgaqdylacnhlksfeyysssilnpdgflaypcdsydkfqengcfp
    cpaggcpkmghyadqykektsaveqtfflntgesgdytswryrvsitlagsgkangylkv
    tlrgsngnskqyeifkgslqpdssytldvdvnfiigkiqevkfvwnktvlnlskpqlgas
    ritvqsgadgteykfcgsgtvqdnveqslypc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w52X (X:)
    kevcytplgcfsddkpwagtlqrplkslpwspeevntrfllytnknpdsyqlitardvat
    ikssnfqssrkthfvihgfrdrgedswpsdmckkilqvettncisvdwssgakaeytqav
    qnirivgaetayliqqlltelsynpenvhiighslgahtageagrrlegrvgrvtgldpa
    epcfqdaseevrldpsdaqfvdvihtdaspmlpslgfgmsqkvghmdffpnggkqmpgck
    rsfidingiwqgaqdylacnhlksfeyysssilnpdgflaypcdsydkfqengcfpcpag
    gcpkmghyadqykektsaveqtfflntgesgdytswryrvsitlagsgkangylkvtlrg
    sngnskqyeifkgslqpdssytldvdvnfiigkiqevkfvwnktvlnlskpqlgasritv
    qsgadgteykfcgsgtvqdnveqslypc