PDB entry 1w4z

View 1w4z on RCSB PDB site
Description: structure of actinorhodin polyketide (actiii) reductase
Deposited on 2004-08-03, released 2004-12-10
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-10, with a file datestamp of 2004-12-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.18466
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1w4za_
  • Chain 'B':
    Domains in SCOP 1.71: d1w4zb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w4zA (A:)
    mgsshhhhhhssglvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcarge
    eglrttlkelreagveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrpgggata
    eladelwldvvetnltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysas
    khgvvgftkalglelartgitvnavcpgfvetpmaasvrehysdiwevsteeafdritar
    vpigryvqpsevaemvayligpgaaavtaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4zA (A:)
    tqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtc
    dvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfrvt
    kqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgitv
    navcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayligp
    gaaavtaqalnvcgglgny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w4zB (B:)
    mgsshhhhhhssglvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcarge
    eglrttlkelreagveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrpgggata
    eladelwldvvetnltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysas
    khgvvgftkalglelartgitvnavcpgfvetpmaasvrehysdiwevsteeafdritar
    vpigryvqpsevaemvayligpgaaavtaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4zB (B:)
    lvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelrea
    gveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvet
    nltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalgl
    elartgitvnavcpgfvetpmaasvrehyteeafdritarvpigryvqpsevaemvayli
    gpgaaavtaqalnvcgglgny