PDB entry 1w4z

View 1w4z on RCSB PDB site
Description: structure of actinorhodin polyketide (actiii) reductase
Class: antibiotic biosynthesis
Keywords: type II polyketide synthesis, ketoreductase, sdr, acp binding, antibiotic biosynthesis
Deposited on 2004-08-03, released 2004-12-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.185
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ketoacyl reductase
    Species: STREPTOMYCES COELICOLOR [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W4Z
    • Uniprot P16544 (Start-280)
    Domains in SCOPe 2.08: d1w4za_
  • Chain 'B':
    Compound: ketoacyl reductase
    Species: STREPTOMYCES COELICOLOR [TaxId:1902]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W4Z (Start-19)
    • Uniprot P16544 (20-280)
    Domains in SCOPe 2.08: d1w4zb1, d1w4zb2
  • Heterogens: NAP, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w4zA (A:)
    mgsshhhhhhssglvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcarge
    eglrttlkelreagveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrpgggata
    eladelwldvvetnltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysas
    khgvvgftkalglelartgitvnavcpgfvetpmaasvrehysdiwevsteeafdritar
    vpigryvqpsevaemvayligpgaaavtaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4zA (A:)
    tqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtc
    dvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvetnltgvfrvt
    kqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgitv
    navcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayligp
    gaaavtaqalnvcgglgny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w4zB (B:)
    mgsshhhhhhssglvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcarge
    eglrttlkelreagveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrpgggata
    eladelwldvvetnltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysas
    khgvvgftkalglelartgitvnavcpgfvetpmaasvrehysdiwevsteeafdritar
    vpigryvqpsevaemvayligpgaaavtaqalnvcgglgny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4zB (B:)
    lvprgshmatqdsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelrea
    gveadgrtcdvrsvpeiealvaavverygpvdvlvnnagrpgggataeladelwldvvet
    nltgvfrvtkqvlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalgl
    elartgitvnavcpgfvetpmaasvrehyteeafdritarvpigryvqpsevaemvayli
    gpgaaavtaqalnvcgglgny