PDB entry 1w4y

View 1w4y on RCSB PDB site
Description: ferrous horseradish peroxidase c1a in complex with carbon monoxide
Class: oxidoreductase
Keywords: oxidoreductase, 3d-structure, carbon monoxide, calcium, ferrous state, glycoprotein, heme, horseradish, iron, multigene family, peroxidase, pyrrolidone carboxylic acid, signal
Deposited on 2004-08-03, released 2005-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.199
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: horseradish peroxidase c1a
    Species: ARMORACIA RUSTICANA [TaxId:3704]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w4ya_
  • Heterogens: HEM, CA, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w4yA (A:)
    qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
    frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
    lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
    mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
    kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
    crvvnsnsllhdmvevvdfvssm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4yA (A:)
    qltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntts
    frtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrvp
    lgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrfi
    mdrlynfsntglpdptlnttylqtlrglcplngnlsalvdfdlrtptifdnkyyvnleeq
    kgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirln
    crvvns