PDB entry 1w4v

View 1w4v on RCSB PDB site
Description: structure of the oxidised form of human thioredoxin 2
Class: oxidoreductase
Keywords: thioredoxin, antioxidant enzyme, mitochondrion, electron transport, oxidoreductase
Deposited on 2004-07-30, released 2005-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.172
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W4V (Start-11)
    • Uniprot Q99757 (12-118)
    Domains in SCOPe 2.07: d1w4va1, d1w4va2
  • Chain 'B':
    Compound: thioredoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W4V (Start-11)
    • Uniprot Q99757 (12-118)
    Domains in SCOPe 2.07: d1w4vb1, d1w4vb2
  • Chain 'C':
    Compound: thioredoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W4V
    • Uniprot Q99757 (12-118)
    Domains in SCOPe 2.07: d1w4vc_
  • Chain 'D':
    Compound: thioredoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W4V (Start-11)
    • Uniprot Q99757 (12-118)
    Domains in SCOPe 2.07: d1w4vd1, d1w4vd2
  • Chain 'E':
    Compound: thioredoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W4V (Start-11)
    • Uniprot Q99757 (12-118)
    Domains in SCOPe 2.07: d1w4ve1, d1w4ve2
  • Chain 'F':
    Compound: thioredoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W4V (Start-11)
    • Uniprot Q99757 (12-118)
    Domains in SCOPe 2.07: d1w4vf1, d1w4vf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w4vA (A:)
    mrgshhhhhhgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakq
    hgkvvmakvdiddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4vA (A:)
    hgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakv
    diddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w4vB (B:)
    mrgshhhhhhgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakq
    hgkvvmakvdiddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4vB (B:)
    hgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakv
    diddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1w4vC (C:)
    mrgshhhhhhgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakq
    hgkvvmakvdiddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4vC (C:)
    ttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakvdid
    dhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1w4vD (D:)
    mrgshhhhhhgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakq
    hgkvvmakvdiddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4vD (D:)
    gsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakvd
    iddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1w4vE (E:)
    mrgshhhhhhgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakq
    hgkvvmakvdiddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4vE (E:)
    hgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakv
    diddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1w4vF (F:)
    mrgshhhhhhgsttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakq
    hgkvvmakvdiddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w4vF (F:)
    sttfniqdgpdfqdrvvnsetpvvvdfhaqwcgpckilgprlekmvakqhgkvvmakvdi
    ddhtdlaieyevsavptvlamkngdvvdkfvgikdedqleaflkklig